Tremella mesenterica: TREMEDRAFT_20130 Help Entry TREMEDRAFT_20130  CDS       T03139                                  Name (RefSeq) hypothetical protein   KO K12412   pheromone receptor transcription factor Organism tms  Tremella mesenterica Pathway tms04011   MAPK signaling pathway - yeast tms04111   Cell cycle - yeast Brite KEGG Orthology (KO) [BR:tms00001]  09130 Environmental Information Processing   09132 Signal transduction    04011 MAPK signaling pathway - yeast     TREMEDRAFT_20130  09140 Cellular Processes   09143 Cell growth and death    04111 Cell cycle - yeast     TREMEDRAFT_20130  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:tms03000]     TREMEDRAFT_20130    03021 Transcription machinery [BR:tms03021]     TREMEDRAFT_20130 Transcription factors [BR:tms03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    MADS-box regulators of differentiation, Yeast regulators     TREMEDRAFT_20130 Transcription machinery [BR:tms03021]  Eukaryotic type   RNA polymerase II system    Other transcription-related factors     Others      TREMEDRAFT_20130 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  SRF-TF Motif Other DBs NCBI-GeneID:  18491236 NCBI-ProteinID:  XP_007006328 JGI:  Treme1_20130 LinkDB All DBs Position Unknown AA seq 96 aa AA seqDB search DVAGGFTFVDGNDSGRRKIRIEYIADKGRRHITFSKRKAGIMKKAYELSILTGTQVLLLV VSETGLVYTFTTPKMQPMVQRPEGKNLIQACLNSPE NT seq 288 nt NT seq  +upstreamnt  +downstreamnt gacgtcgccggagggttcacctttgtagatgggaacgattctgggcgtaggaagattcgt atagaatacatcgcggacaaggggcgtagacatatcactttttccaagcgcaaagcgggg atcatgaagaaggcatacgaactttctatcctcactggcactcaagtcctcctactggtc gtgtctgaaactggactcgtgtacactttcacaacgcctaaaatgcaacctatggtgcag aggcccgaaggaaagaatttgattcaagcatgtctcaactctcccgaa

DBGET integrated database retrieval system