Tremella mesenterica: TREMEDRAFT_24108 Help Entry TREMEDRAFT_24108  CDS       T03139                                  Name (RefSeq) hypothetical protein   KO K12626   U6 snRNA-associated Sm-like protein LSm7 Organism tms  Tremella mesenterica Pathway tms03018   RNA degradation tms03040   Spliceosome Brite KEGG Orthology (KO) [BR:tms00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     TREMEDRAFT_24108   09123 Folding, sorting and degradation    03018 RNA degradation     TREMEDRAFT_24108  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:tms03019]     TREMEDRAFT_24108    03041 Spliceosome [BR:tms03041]     TREMEDRAFT_24108 Messenger RNA biogenesis [BR:tms03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      TREMEDRAFT_24108   mRNA degradation factors    5'-3' decay     Lsm complex      TREMEDRAFT_24108 Spliceosome [BR:tms03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     TREMEDRAFT_24108 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  LSM DUF6897 NAD_Gly3P_dh_N Motif Other DBs NCBI-GeneID:  18491337 NCBI-ProteinID:  XP_007000475 JGI:  Treme1_24108 LinkDB All DBs Position Unknown AA seq 79 aa AA seqDB search EKKKRESILNLANYVDKSIRVKFMGAREVTGTLKGFDQLMNLVMDDVVEEFENGMPSRSL GLVVLRGPNITLILPTDGS NT seq 237 nt NT seq  +upstreamnt  +downstreamnt gagaaaaagaagagagaatcaattttgaatctggcgaattatgttgacaagtccatccgg gtcaaattcatgggtgcgagggaggtgacaggcactttgaaaggtttcgatcaacttatg aaccttgtaatggacgatgtagttgaagaattcgaaaacggtatgccttctcgatcatta ggtttggtagttcttcgaggacctaatataacacttatattacctaccgatggatct

DBGET integrated database retrieval system