Tremella mesenterica: TREMEDRAFT_24691 Help Entry TREMEDRAFT_24691  CDS       T03139                                  Name (RefSeq) hypothetical protein   KO K03016   DNA-directed RNA polymerases I, II, and III subunit RPABC3 Organism tms  Tremella mesenterica Pathway tms03020   RNA polymerase tms03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:tms00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     TREMEDRAFT_24691   09124 Replication and repair    03420 Nucleotide excision repair     TREMEDRAFT_24691  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:tms03021]     TREMEDRAFT_24691    03400 DNA repair and recombination proteins [BR:tms03400]     TREMEDRAFT_24691 Transcription machinery [BR:tms03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      TREMEDRAFT_24691   RNA polymerase III system    RNA polymerase III      TREMEDRAFT_24691   RNA polymerase I system    RNA polymerase I      TREMEDRAFT_24691 DNA repair and recombination proteins [BR:tms03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       TREMEDRAFT_24691 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_Rpb8 Motif Other DBs NCBI-GeneID:  18491396 NCBI-ProteinID:  XP_007000530 JGI:  Treme1_24691 LinkDB All DBs Position Unknown AA seq 156 aa AA seqDB search MAETNNILFEDRFIVDEVDKGGKKFDRVSRIEATSQNSRMSLVLDIANELYPLNPRETFT LALARSLLSEGEQIDGDADLDGEENGGGGGGKKVKRELWRGGDQGLADDYEYVMYGKVTG ITAYISFGGLLMALRGPYRHLTGITVGQNVYLLIRK NT seq 471 nt NT seq  +upstreamnt  +downstreamnt atggcagaaaccaataacatcttattcgaagatcggttcattgtggatgaagtagataaa ggtggtaagaaattcgatagagtatcaagaatagaagcaacatctcaaaattcaagaatg tctttagtactcgatatagcgaatgaactttatcctttaaatcctagagaaactttcaca ttagctttagctagatcattattgagtgaaggtgaacaaattgatggtgatgcggattta gatggggaagaaaatggtggtggtggtggtgggaaaaaagtgaaaagagaattatggaga ggtggtgatcaaggtttggcagatgattatgaatatgtcatgtatggtaaagttactggg ataacggcctatatatccttcggtggtctcttaatggcactcagaggtccatatagacat ttgacaggaataactgtcggtcaaaatgtttatcttctcatacgaaaatga

DBGET integrated database retrieval system