Tremella mesenterica: TREMEDRAFT_28632 Help Entry TREMEDRAFT_28632  CDS       T03139                                  Name (RefSeq) hypothetical protein   KO K07342   protein transport protein SEC61 subunit gamma and related proteins Organism tms  Tremella mesenterica Pathway tms03060   Protein export tms04141   Protein processing in endoplasmic reticulum tms04145   Phagosome Brite KEGG Orthology (KO) [BR:tms00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     TREMEDRAFT_28632    04141 Protein processing in endoplasmic reticulum     TREMEDRAFT_28632  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     TREMEDRAFT_28632  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tms04131]     TREMEDRAFT_28632   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:tms02044]     TREMEDRAFT_28632 Membrane trafficking [BR:tms04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     TREMEDRAFT_28632 Secretion system [BR:tms02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    TREMEDRAFT_28632 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  SecE Motif Other DBs NCBI-GeneID:  18491889 NCBI-ProteinID:  XP_007003198 JGI:  Treme1_28632 LinkDB All DBs Position Unknown AA seq 62 aa AA seqDB search MSERLRELAEVPQAFIKEGTLFVNRCTKPTQKEYIQLCRAIAVGFAIMGFIGFFVKLIHI PM NT seq 189 nt NT seq  +upstreamnt  +downstreamnt atgtctgaaagattaagagaactagcagaggttcctcaagcattcattaaagagggtact ctgtttgtgaaccgatgtactaaacccactcaaaaagaatatatccagctgtgtagagct atagcggtaggatttgccatcatgggattcattgggttcttcgtaaaattgattcatata cccatgtaa

DBGET integrated database retrieval system