Tremella mesenterica: TREMEDRAFT_29158 Help Entry TREMEDRAFT_29158  CDS       T03139                                  Name (RefSeq) hypothetical protein   KO K12624   U6 snRNA-associated Sm-like protein LSm5 Organism tms  Tremella mesenterica Pathway tms03018   RNA degradation tms03040   Spliceosome Brite KEGG Orthology (KO) [BR:tms00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     TREMEDRAFT_29158   09123 Folding, sorting and degradation    03018 RNA degradation     TREMEDRAFT_29158  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:tms03019]     TREMEDRAFT_29158    03041 Spliceosome [BR:tms03041]     TREMEDRAFT_29158 Messenger RNA biogenesis [BR:tms03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      TREMEDRAFT_29158   mRNA degradation factors    5'-3' decay     Lsm complex      TREMEDRAFT_29158 Spliceosome [BR:tms03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     TREMEDRAFT_29158 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  LSM SM-ATX KOW7_SPT5 DUF150_C Hfq Motif Other DBs NCBI-GeneID:  18491962 NCBI-ProteinID:  XP_007003271 JGI:  Treme1_29158 LinkDB All DBs Position Unknown AA seq 85 aa AA seqDB search MASTILPLELVDRCIGSPIHVIMKNEREFTGTLMGFDDYVNMVLRDVKEYQVTPGGIIET PLGQTLLNGNNIVMLIPGGRGPKAI NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggcttcaaccatccttcctttagaattggtagatagatgtataggttctcccatacat gtgatcatgaagaacgagagagagtttacaggtactttgatggggtttgatgattatgtt aatatggttttacgagatgtaaaagaatatcaagtaacacctggtggaatcatagaaact cctcttggtcaaacattattaaatgggaataatatcgtcatgctcattcctggtggaaga ggacctaaagctatatga

DBGET integrated database retrieval system