Tremella mesenterica: TREMEDRAFT_35439 Help Entry TREMEDRAFT_35439  CDS       T03139                                  Name (RefSeq) hypothetical protein   KO K10419   dynein light chain roadblock-type Organism tms  Tremella mesenterica Pathway tms04814   Motor proteins Brite KEGG Orthology (KO) [BR:tms00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     TREMEDRAFT_35439  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tms04131]     TREMEDRAFT_35439   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:tms03037]     TREMEDRAFT_35439    04812 Cytoskeleton proteins [BR:tms04812]     TREMEDRAFT_35439 Membrane trafficking [BR:tms04131]  Endosome - Golgi transport   Rab GTPases and associated proteins    Rab associated proteins     TREMEDRAFT_35439 Cilium and associated proteins [BR:tms03037]  Motile cilia and associated proteins   Dynein arm    TREMEDRAFT_35439 Cytoskeleton proteins [BR:tms04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      TREMEDRAFT_35439 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Robl_LC7 Motif Other DBs NCBI-GeneID:  18492697 NCBI-ProteinID:  XP_007007991 JGI:  Treme1_35439 LinkDB All DBs Position Unknown AA seq 83 aa AA seqDB search MVLFRRGVDGGGIVQSTGTVFEGENGQRYARELEGVVEGVTKAVGECDSGDQLRFMRIRT KRHELIITPDEKYVLVVLQDPGQ NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atggttttgttccgacgtggggttgatggaggtgggatcgtacagagtacagggacggtt ttcgaaggtgagaatgggcagaggtatgctagggagttagaaggtgttgtggaaggtgtt actaaggctgttggggagtgtgattctggggaccaacttcgcttcatgcgtatacggact aaacgacatgaactcataataacccctgacgagaaatacgtgttggtggtattacaagat ccggggcagtga

DBGET integrated database retrieval system