Tremella mesenterica: TREMEDRAFT_57528 Help Entry TREMEDRAFT_57528  CDS       T03139                                  Name (RefSeq) hypothetical protein   KO K09481   protein transport protein SEC61 subunit beta Organism tms  Tremella mesenterica Pathway tms03060   Protein export tms04141   Protein processing in endoplasmic reticulum tms04145   Phagosome Brite KEGG Orthology (KO) [BR:tms00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     TREMEDRAFT_57528    04141 Protein processing in endoplasmic reticulum     TREMEDRAFT_57528  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     TREMEDRAFT_57528  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tms04131]     TREMEDRAFT_57528   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:tms02044]     TREMEDRAFT_57528 Membrane trafficking [BR:tms04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     TREMEDRAFT_57528 Secretion system [BR:tms02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    TREMEDRAFT_57528 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Sec61_beta Motif Other DBs NCBI-GeneID:  18494068 NCBI-ProteinID:  XP_007006444 JGI:  Treme1_57528 LinkDB All DBs Position Unknown AA seq 101 aa AA seqDB search MSDIDRPTSPNGGTGASSAFAVARPHGANAVRRRAAAAPRPNSARAAGAGGSSNTMLKLY TDSGDAGLKVDPFVVIVLSLSFIASIFFLHIAAKVVRAITK NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgtccgatatagatagacctacttctcccaacggtggaacaggagcttcttcagctttc gcagttgccagacctcacggtgctaatgctgttcgacgtcgagcagcagcggctcctcga cctaactctgctagggctgcaggagcgggaggatcaagtaatacaatgttaaaactttat accgattcgggcgatgctggattgaaagtcgatccattcgtcgttatcgtcctctcactc tctttcatagcatccatctttttcctccatatagccgcaaaagtcgtgagggccattacc aagtga

DBGET integrated database retrieval system