KEGG   Trichechus manatus latirostris (Florida manatee): 101342804
Entry
101342804         CDS       T05135                                 
Name
(RefSeq) GTPase HRas isoform X2
  KO
K02833  GTPase HRas
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu01521  EGFR tyrosine kinase inhibitor resistance
tmu01522  Endocrine resistance
tmu04010  MAPK signaling pathway
tmu04012  ErbB signaling pathway
tmu04014  Ras signaling pathway
tmu04015  Rap1 signaling pathway
tmu04062  Chemokine signaling pathway
tmu04068  FoxO signaling pathway
tmu04071  Sphingolipid signaling pathway
tmu04072  Phospholipase D signaling pathway
tmu04137  Mitophagy - animal
tmu04140  Autophagy - animal
tmu04144  Endocytosis
tmu04150  mTOR signaling pathway
tmu04151  PI3K-Akt signaling pathway
tmu04210  Apoptosis
tmu04211  Longevity regulating pathway
tmu04213  Longevity regulating pathway - multiple species
tmu04218  Cellular senescence
tmu04360  Axon guidance
tmu04370  VEGF signaling pathway
tmu04371  Apelin signaling pathway
tmu04510  Focal adhesion
tmu04540  Gap junction
tmu04550  Signaling pathways regulating pluripotency of stem cells
tmu04625  C-type lectin receptor signaling pathway
tmu04630  JAK-STAT signaling pathway
tmu04650  Natural killer cell mediated cytotoxicity
tmu04660  T cell receptor signaling pathway
tmu04662  B cell receptor signaling pathway
tmu04664  Fc epsilon RI signaling pathway
tmu04714  Thermogenesis
tmu04720  Long-term potentiation
tmu04722  Neurotrophin signaling pathway
tmu04725  Cholinergic synapse
tmu04726  Serotonergic synapse
tmu04730  Long-term depression
tmu04810  Regulation of actin cytoskeleton
tmu04910  Insulin signaling pathway
tmu04912  GnRH signaling pathway
tmu04915  Estrogen signaling pathway
tmu04916  Melanogenesis
tmu04917  Prolactin signaling pathway
tmu04919  Thyroid hormone signaling pathway
tmu04921  Oxytocin signaling pathway
tmu04926  Relaxin signaling pathway
tmu04929  GnRH secretion
tmu04933  AGE-RAGE signaling pathway in diabetic complications
tmu04935  Growth hormone synthesis, secretion and action
tmu05010  Alzheimer disease
tmu05022  Pathways of neurodegeneration - multiple diseases
tmu05034  Alcoholism
tmu05132  Salmonella infection
tmu05160  Hepatitis C
tmu05161  Hepatitis B
tmu05163  Human cytomegalovirus infection
tmu05165  Human papillomavirus infection
tmu05166  Human T-cell leukemia virus 1 infection
tmu05167  Kaposi sarcoma-associated herpesvirus infection
tmu05170  Human immunodeficiency virus 1 infection
tmu05200  Pathways in cancer
tmu05203  Viral carcinogenesis
tmu05205  Proteoglycans in cancer
tmu05206  MicroRNAs in cancer
tmu05207  Chemical carcinogenesis - receptor activation
tmu05208  Chemical carcinogenesis - reactive oxygen species
tmu05210  Colorectal cancer
tmu05211  Renal cell carcinoma
tmu05213  Endometrial cancer
tmu05214  Glioma
tmu05215  Prostate cancer
tmu05216  Thyroid cancer
tmu05218  Melanoma
tmu05219  Bladder cancer
tmu05220  Chronic myeloid leukemia
tmu05221  Acute myeloid leukemia
tmu05223  Non-small cell lung cancer
tmu05224  Breast cancer
tmu05225  Hepatocellular carcinoma
tmu05226  Gastric cancer
tmu05230  Central carbon metabolism in cancer
tmu05231  Choline metabolism in cancer
tmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
tmu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101342804
   04012 ErbB signaling pathway
    101342804
   04014 Ras signaling pathway
    101342804
   04015 Rap1 signaling pathway
    101342804
   04370 VEGF signaling pathway
    101342804
   04371 Apelin signaling pathway
    101342804
   04630 JAK-STAT signaling pathway
    101342804
   04068 FoxO signaling pathway
    101342804
   04072 Phospholipase D signaling pathway
    101342804
   04071 Sphingolipid signaling pathway
    101342804
   04151 PI3K-Akt signaling pathway
    101342804
   04150 mTOR signaling pathway
    101342804
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101342804
   04140 Autophagy - animal
    101342804
   04137 Mitophagy - animal
    101342804
  09143 Cell growth and death
   04210 Apoptosis
    101342804
   04218 Cellular senescence
    101342804
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101342804
   04540 Gap junction
    101342804
   04550 Signaling pathways regulating pluripotency of stem cells
    101342804
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101342804
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101342804
   04650 Natural killer cell mediated cytotoxicity
    101342804
   04660 T cell receptor signaling pathway
    101342804
   04662 B cell receptor signaling pathway
    101342804
   04664 Fc epsilon RI signaling pathway
    101342804
   04062 Chemokine signaling pathway
    101342804
  09152 Endocrine system
   04910 Insulin signaling pathway
    101342804
   04929 GnRH secretion
    101342804
   04912 GnRH signaling pathway
    101342804
   04915 Estrogen signaling pathway
    101342804
   04917 Prolactin signaling pathway
    101342804
   04921 Oxytocin signaling pathway
    101342804
   04926 Relaxin signaling pathway
    101342804
   04935 Growth hormone synthesis, secretion and action
    101342804
   04919 Thyroid hormone signaling pathway
    101342804
   04916 Melanogenesis
    101342804
  09156 Nervous system
   04725 Cholinergic synapse
    101342804
   04726 Serotonergic synapse
    101342804
   04720 Long-term potentiation
    101342804
   04730 Long-term depression
    101342804
   04722 Neurotrophin signaling pathway
    101342804
  09158 Development and regeneration
   04360 Axon guidance
    101342804
  09149 Aging
   04211 Longevity regulating pathway
    101342804
   04213 Longevity regulating pathway - multiple species
    101342804
  09159 Environmental adaptation
   04714 Thermogenesis
    101342804
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101342804
   05206 MicroRNAs in cancer
    101342804
   05205 Proteoglycans in cancer
    101342804
   05207 Chemical carcinogenesis - receptor activation
    101342804
   05208 Chemical carcinogenesis - reactive oxygen species
    101342804
   05203 Viral carcinogenesis
    101342804
   05230 Central carbon metabolism in cancer
    101342804
   05231 Choline metabolism in cancer
    101342804
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101342804
  09162 Cancer: specific types
   05210 Colorectal cancer
    101342804
   05225 Hepatocellular carcinoma
    101342804
   05226 Gastric cancer
    101342804
   05214 Glioma
    101342804
   05216 Thyroid cancer
    101342804
   05221 Acute myeloid leukemia
    101342804
   05220 Chronic myeloid leukemia
    101342804
   05218 Melanoma
    101342804
   05211 Renal cell carcinoma
    101342804
   05219 Bladder cancer
    101342804
   05215 Prostate cancer
    101342804
   05213 Endometrial cancer
    101342804
   05224 Breast cancer
    101342804
   05223 Non-small cell lung cancer
    101342804
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101342804
   05170 Human immunodeficiency virus 1 infection
    101342804
   05161 Hepatitis B
    101342804
   05160 Hepatitis C
    101342804
   05163 Human cytomegalovirus infection
    101342804
   05167 Kaposi sarcoma-associated herpesvirus infection
    101342804
   05165 Human papillomavirus infection
    101342804
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101342804
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101342804
   05022 Pathways of neurodegeneration - multiple diseases
    101342804
  09165 Substance dependence
   05034 Alcoholism
    101342804
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101342804
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101342804
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101342804
   01522 Endocrine resistance
    101342804
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tmu04131]
    101342804
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tmu04147]
    101342804
   04031 GTP-binding proteins [BR:tmu04031]
    101342804
Membrane trafficking [BR:tmu04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    101342804
 Endocytosis
  Macropinocytosis
   Ras GTPases
    101342804
Exosome [BR:tmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101342804
  Exosomal proteins of colorectal cancer cells
   101342804
GTP-binding proteins [BR:tmu04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    101342804
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 FeoB_N Septin G-alpha CdhD AAA_33 Ldh_1_N nSTAND3
Other DBs
NCBI-GeneID: 101342804
NCBI-ProteinID: XP_004389430
UniProt: A0A2Y9EA67
LinkDB
Position
Unknown
AA seq 170 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDVHQYREQIKRVKDSDDVPMVLVGNKCDL
PARTVESRQAQELARSYGLPYIETSAKTRQGSRSGSGSSSGTPRDPLGPV
NT seq 513 nt   +upstreamnt  +downstreamnt
atgacggagtacaagctggtggtggtgggcgcgggtggcgtggggaagagcgccctgacc
atccagctcatccagaaccactttgtggatgagtacgaccccaccattgaggactcgtac
cggaagcaggtggtcattgacggggagacgtgcctgctggacatcctggacacggcaggg
caggaggagtacagcgccatgcgggaccagtacatgcgcacgggcgagggcttcctctgc
gtgttcgccatcaacaacaccaagtctttcgaggacgttcaccagtacagggagcagatc
aagcgggtgaaggactcagacgatgtgcccatggtgctggtggggaacaagtgtgacctg
cctgcccgcaccgtggagtcacggcaggcccaggaacttgcccgcagctacggacttccc
tacatcgagacctctgccaagacccgccagggcagccgctctggctctggctccagctcc
gggaccccccgggaccccttgggacccgtgtga

DBGET integrated database retrieval system