KEGG   Trichechus manatus latirostris (Florida manatee): 101355670
Entry
101355670         CDS       T05135                                 
Name
(RefSeq) nucleolar protein 3
  KO
K28177  nucleolar protein 3
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101355670
SSDB
Motif
Pfam: CARD Trypan_PARP RskA_N
Other DBs
NCBI-GeneID: 101355670
NCBI-ProteinID: XP_004371709
UniProt: A0A2Y9DBQ1
LinkDB
Position
Unknown
AA seq 208 aa
MGNAQERPSETIDRERKRLVETLQAESGLLLDALLARGMLTGAEYEALDAMPDAERRVRR
LLLLVQGKGEAACNELLHCAQRVARAPDPVWDWQHVGPGYRDRSYDPPCPGHGTPETPGS
GTTCPGLPRASDWDEAGGPEGSGAVQSQIREEPNLELEAEASEGAEPEPEPQMNPGPELE
AEPEPELEQEPDPEPEPDCEAADESEGS
NT seq 627 nt   +upstreamnt  +downstreamnt
atgggcaacgcgcaggagcggccgtcggagacgatcgaccgcgaacggaaacgcctggta
gagacactgcaggcggagtctgggctactgctggacgcgttgctggcgcggggcatgctc
accggggcggagtacgaggcgttggacgcgatgcctgatgccgagcgcagggtgcgccgg
ctgttgctgctggtgcagggcaagggcgaggccgcctgcaacgagctgctgcactgcgcc
cagcgtgtggcgcgtgcgcctgaccctgtttgggactggcagcacgttggccctggctac
agggaccgcagctacgaccctccgtgcccaggccacgggacgcctgagacacctggctca
gggactacatgccccggactgcccagagcttctgactgggatgaggctgggggtcctgag
ggctctggggcggtgcaatcccagatccgcgaggagcccaatctggagctggaagctgag
gcctctgaaggggctgagccggagccggaacctcaaatgaatccgggaccagaactggag
gcagaaccagagcctgaactggagcaagagcccgacccagagccagaacccgactgcgag
gccgcggatgagtccgaaggttcctga

DBGET integrated database retrieval system