KEGG   Trichechus manatus latirostris (Florida manatee): 101356865
Entry
101356865         CDS       T05135                                 
Name
(RefSeq) ATP synthase F(0) complex subunit C2, mitochondrial
  KO
K02128  F-type H+-transporting ATPase subunit c
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu00190  Oxidative phosphorylation
tmu01100  Metabolic pathways
tmu04714  Thermogenesis
tmu05010  Alzheimer disease
tmu05012  Parkinson disease
tmu05014  Amyotrophic lateral sclerosis
tmu05016  Huntington disease
tmu05020  Prion disease
tmu05022  Pathways of neurodegeneration - multiple diseases
tmu05208  Chemical carcinogenesis - reactive oxygen species
tmu05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101356865
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    101356865
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    101356865
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101356865
   05012 Parkinson disease
    101356865
   05014 Amyotrophic lateral sclerosis
    101356865
   05016 Huntington disease
    101356865
   05020 Prion disease
    101356865
   05022 Pathways of neurodegeneration - multiple diseases
    101356865
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    101356865
SSDB
Motif
Pfam: ATP-synt_C Spp-24
Other DBs
NCBI-GeneID: 101356865
NCBI-ProteinID: XP_023584693
UniProt: A0A2Y9QZC7
LinkDB
Position
Unknown
AA seq 268 aa
MASLGVPGNCSVGFQRGFLSPAGVCLAAARLSSGTVKLLPWSDWPNAATELAGGAVAPGP
TLYVAVILSSTERLVGPGGAILSSTARLVGPGGACAEPSLPQSSTPCPLCLLCTWSSSSA
TAPHPLKMYICAKFVSTPSLVRSTSQLLSRPLSAVVLKQPQALTDEGFSSLTAPHSLTSL
IPSRSFQTTAISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLF
SYAILGFALSEAMGLFCLMVAFLILFAM
NT seq 807 nt   +upstreamnt  +downstreamnt
atggcgtcgctcggggtcccgggaaattgctccgtgggctttcagcgggggtttttatcg
ccggccggggtgtgcctggctgcggctcgcctctcctccgggaccgtaaagctgctgccg
tggagcgactggccgaatgcagccaccgagctggcgggcggcgctgtagcgcccgggccg
accctctacgttgcagtcattctatcttcgacggagcgactcgttggcccgggcggcgcc
attctatcttcgacggcgcgactcgttggcccgggcggcgcatgcgctgagccttccctc
ccgcaatcttcaaccccctgccctctctgtcttctctgcacttggagcagctcttctgcc
acagcccctcatcccctgaaaatgtacatctgcgccaagtttgtctccactccctccttg
gtcaggagcacctctcagctgctgagccgaccgttgtctgcagtggtgctgaaacaaccc
caggcactgacagatgagggtttcagcagcttgacagccccgcattccctgacttcactt
atccctagtcgcagcttccaaacgaccgccatctcaagggacatcgacacagcagccaag
ttcattggtgctggggctgccacagtcggagtggctggctctggagctgggattgggact
gtgtttgggagcctcatcattggttatgcgaggaacccttctctgaagcagcagctcttc
tcctacgccattctgggctttgccctctcagaagccatgggactcttttgcctgatggtg
gcctttctgatcctcttcgccatgtga

DBGET integrated database retrieval system