Taurinivorans muris: JBF11_04475 Help Entry JBF11_04475       CDS       T09798                                  Symbol zapB Name (GenBank) cell division protein ZapB   KO K09892   cell division protein ZapB Organism tmur  Taurinivorans muris Brite KEGG Orthology (KO) [BR:tmur00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tmur03036]     JBF11_04475 (zapB) Chromosome and associated proteins [BR:tmur03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     JBF11_04475 (zapB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB Herpes_UL6 DUF5339 TMF_DNA_bd DUF3972 DUF3450 Suppressor_APC ADIP YwqH-like Taxilin Seryl_tRNA_N Snapin_Pallidin DUF4763 FlaC_arch NRBF2 HALZ DUF1192 Sec3_CC CDC13_N ERM_helical ATP-synt_D Crescentin 7TMR-HDED DUF6507 DUF2205 Csm1_N NET2A JIP_LZII Cep57_CLD_2 OVT1 GAS Spectrin_SESTD1 Mce4_CUP1 Occludin_ELL FUT8_N_cat Prefoldin_2 YabA ATG16 TMF_TATA_bd DUF948 DUF2203 Prominin Cnn_1N DUF6444 Motif Other DBs NCBI-ProteinID:  UWX06566 LinkDB All DBs Position 953290..953520 Genome browser AA seq 76 aa AA seqDB search MELLELLEKRVDALLAEIERLRTENSVLQEQLSSYEQKLEESSQYIGTLKSEQQNVQLVK ERLEVLMQKIETVLTE NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggaacttttagaacttttagaaaaacgtgtagatgcattacttgcggaaattgaaaga ttaagaacagaaaactcggttttgcaagagcagctttcctcttatgaacaaaaattggaa gaaagttctcaatatattggtacgctcaagagcgaacagcaaaacgtacaacttgtgaaa gaacgtcttgaagtattaatgcaaaaaattgaaactgttttaaccgaataa

DBGET integrated database retrieval system