KEGG   Termitidicoccus mucosus: OH491_23505
Entry
OH491_23505       CDS       T09991                                 
Name
(GenBank) SulP family inorganic anion transporter
  KO
K03321  sulfate permease, SulP family
Organism
tmv  Termitidicoccus mucosus
Brite
KEGG Orthology (KO) [BR:tmv00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tmv02000]
    OH491_23505
Transporters [BR:tmv02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   OH491_23505
SSDB
Motif
Pfam: Sulfate_transp STAS MFS_MOT1 STAS_2
Other DBs
NCBI-ProteinID: XAE55885
LinkDB
Position
complement(6616548..6618320)
AA seq 590 aa
MLANEETVRSKLARFRPKLVDALQGYSKEKFLKDLMAGLTVGVVALSLCIGLGVASGVPP
AAGLYAGIIGGFLVSALGGSRVQVGGPAGAFVGLLALMGAKYGLPNLLMCTMLAGLMLFA
MGLLKMGALIKFVPQPVTAGFTCGIAITILLTQVKPFFGLEIVAEPAEFLPRIVALVQAA
GTVNWTTVIISVLSLAVLGKWPVRYSRYVPGSIVVVIAGTLLAGLSQLSWVEGWFHLNTA
TIGSAFGEIPRGLPSFSWPRFDWQQLNNLVGPAFTIAVLCAIESLLSAVVADGLIDDQHD
SNQELMGQGVANFVSPLFGGIPVTGVIARTATNIRNGAQTPVAGIVHSLFLLVVLLVAAP
LAKYIPLASLAAVLISVGWKMGEWGEFRRLRKRPQGDAAVFLATFVLTVCFDLTIAVTVG
MLLACFLFIKRVTETTQVQSMSGDGRQDAHQPGHGTHEELQEKLPDGVVIYRVFGALLFG
AADKLDTVLRRGITDTRVVIFHMMAVTAMDVTALDRLENLQAKLKRNGRHLILCGPHTQA
YFMMAKAGFLDEVGEANVMPDLPSSVTRAKELLAAGNAAKAGPAPAGAPA
NT seq 1773 nt   +upstreamnt  +downstreamnt
atgctcgcaaatgaggaaacagtccgctcaaaactcgcccgcttcaggccgaagctggtc
gatgccctccaaggctactcgaaagagaagtttttgaaggacttgatggcgggactcacc
gtcggcgtggtggcgctttcgttgtgcatcggcctgggcgtggcatcgggcgtgcccccg
gcggccggcctgtatgccggcatcatcggcggcttcctggtgtcggcgctcggcggctcg
cgcgtgcaggtgggcggaccggcgggggcgtttgtcggcttgctggcgctgatgggcgcg
aaatacgggctgcccaacctgctcatgtgcacgatgctcgcgggtttgatgctgttcgcg
atggggctgttgaagatgggcgcgctcatcaagtttgtgccgcagccggtgacggcgggc
ttcacgtgcggcatcgccatcacgattttgctcacgcaggtgaagccgtttttcggcctc
gaaatcgtcgctgagcccgcggagttccttccgcgcatcgtggcgctggtgcaggcggcg
ggcacggtcaattggacgacggtgatcatctcggtcctgtccctcgcggttcttgggaaa
tggccggtgcgctacagccgttatgtgccgggctccatcgtcgtggtgatcgccggcacg
ttgctggccgggctctcgcagctgtcgtgggtggagggttggtttcacctgaacacggcc
accatcgggtcggccttcggcgaaatcccgcgcgggctgccctcgttttcctggccgcgc
tttgactggcagcaactgaacaatctcgtcggccccgcgttcaccattgcggtcctgtgc
gccatcgagtcgctgctgtcggccgtggtggcggacgggctcatcgacgaccagcacgat
tcgaaccaggagctcatgggccagggcgtggcgaattttgtgtcccccctcttcggcggc
atcccggtgacgggtgtcatcgcgcgcacggccaccaacatccgcaacggcgcgcagacg
ccggtggcgggcatcgtgcactcgctgttcctgctggtggtgctgctggtggccgcgccg
ctggcgaaatacatcccgctggcctcgctggccgcggtgttgatttccgtgggctggaag
atgggcgaatggggcgagtttcggcgcctgagaaaacgcccgcagggcgacgccgcggtg
ttcctggcgacatttgtcctgaccgtgtgcttcgatctcacgatcgcggtcacggtcggc
atgctgctggcgtgcttcctcttcatcaagcgcgtgaccgagaccacgcaggtgcagtcg
atgagcggcgacgggcggcaggacgcgcaccagccgggacacggcacgcacgaggaattg
caggaaaagctgcccgacggcgtggtgatctaccgcgtgttcggcgcgctgctcttcggc
gcggccgacaagctcgacaccgtgctgcgccgcggcatcacggacacgcgcgtggtgatt
ttccacatgatggccgtgaccgcgatggacgtgacggcgctcgaccggctggaaaacttg
caggcgaaactgaagcgcaacggccgccacctgattctctgcgggccgcacacgcaggcg
tatttcatgatggccaaggccggcttcctcgacgaggtcggcgaggcgaacgtgatgccc
gacctgccctcgtcggtgacgcgggccaaggaattgctggccgcgggaaacgcggccaag
gccggtccggcgccggccggggcgcccgcgtaa

DBGET integrated database retrieval system