Thermotoga maritima MSB8: THMA_0901 Help Entry THMA_0901         CDS       T03902                                  Name (GenBank) ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism tmw  Thermotoga maritima MSB8 Pathway tmw00020   Citrate cycle (TCA cycle) tmw00720   Other carbon fixation pathways tmw01100   Metabolic pathways tmw01110   Biosynthesis of secondary metabolites tmw01120   Microbial metabolism in diverse environments tmw01200   Carbon metabolism tmw01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:tmw00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     THMA_0901   09102 Energy metabolism    00720 Other carbon fixation pathways     THMA_0901 Enzymes [BR:tmw01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      THMA_0901 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_6 Fer4_2 Fer4_7 Fer4_21 Fer4_10 Fer4_9 Fer4_16 LdpA_Fe-S-bd Fer4_4 Fer4_13 Fer4_3 Fer4_17 Fer4_8 Fer4_15 Fer4_22 Motif Other DBs NCBI-ProteinID:  AKE28658 UniProt:  Q9WZY1 LinkDB All DBs Position complement(902049..902246) Genome browser AA seq 65 aa AA seqDB search MGYKIVVNYDWCKACKLCAWACPTSAITSDEIGKPVTNENKCIGCLKCEKICPDMAIEIV SDENA NT seq 198 nt NT seq  +upstreamnt  +downstreamnt atgggttacaagatcgtggtgaattacgactggtgcaaagcgtgtaagctgtgcgcgtgg gcttgtccgactagtgccattacaagcgatgaaataggaaaacccgtgacaaacgaaaac aaatgcatcggatgtttaaaatgtgagaaaatatgtccggatatggccatagaaattgtg agtgatgagaatgcctga

DBGET integrated database retrieval system