Pyrobaculum neutrophilum: Tneu_0424 Help Entry Tneu_0424         CDS       T00682                                  Name (GenBank) ferredoxin   KO K00240   succinate dehydrogenase iron-sulfur subunit [EC:1.3.5.1] Organism tne  Pyrobaculum neutrophilum Pathway tne00020   Citrate cycle (TCA cycle) tne00190   Oxidative phosphorylation tne00650   Butanoate metabolism tne00720   Other carbon fixation pathways tne01100   Metabolic pathways tne01110   Biosynthesis of secondary metabolites tne01120   Microbial metabolism in diverse environments tne01200   Carbon metabolism Module tne_M00374   Dicarboxylate-hydroxybutyrate cycle Brite KEGG Orthology (KO) [BR:tne00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     Tneu_0424    00650 Butanoate metabolism     Tneu_0424   09102 Energy metabolism    00190 Oxidative phosphorylation     Tneu_0424    00720 Other carbon fixation pathways     Tneu_0424 Enzymes [BR:tne01000]  1. Oxidoreductases   1.3  Acting on the CH-CH group of donors    1.3.5  With a quinone or related compound as acceptor     1.3.5.1  succinate dehydrogenase      Tneu_0424 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer2_3 Fer2 Fer2_4 Motif Other DBs NCBI-ProteinID:  ACB39372 UniProt:  B1YBY8 LinkDB All DBs Position 384366..384668 Genome browser AA seq 100 aa AA seqDB search MRVKVHVKRGREGAQYYQTYEVEAPESTTVLDLLLSIRETLDGSLSMRYACRMGVCGACT MVINGVPRLACAVKISDLKTDEIFVEPLRGKKVIKDLVTE NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgagggtgaaggtacacgttaagaggggtagagagggggcgcagtactaccagacctac gaagtggaggcgccggagagcaccacggtgctggacctcctcctctcgattagggagacg ctggacggtagcctctccatgaggtacgcctgcaggatgggcgtctgcggcgcctgcacc atggtcataaacggcgtgccgaggctcgcatgcgccgtaaagatctccgacttgaaaaca gacgagatcttcgtggagcctctacgggggaagaaggtaattaaggatttagttactgaa taa

DBGET integrated database retrieval system