KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00029281G001
Entry
GSTEN00029281G001 CDS       T04346                                 
Name
(GenBank) unnamed protein product
  KO
K22733  magnesium transporter
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Brite
KEGG Orthology (KO) [BR:tng00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tng02000]
    GSTEN00029281G001
Transporters [BR:tng02000]
 Solute carrier family (SLC)
  SLC57: NiPA-like magnesium transporter
   GSTEN00029281G001
SSDB
Motif
Pfam: Mg_trans_NIPA EamA DUF7471
Other DBs
NCBI-ProteinID: CAG08331
UniProt: Q4RTF1
LinkDB
Position
1
AA seq 323 aa
MEVNRLDFYIGLALAVSSSVFIGASFILKKKGLLRLARKGSTRAGQGGHAYLKEWLWWAG
LISSNLSFVCISVGIGEAANFAAYIFAPATLVTPLGALSVLVSAVFSSYFLNERLNIHGK
VGCLLSILGSTVMVIHAPQEEEVGSLDAMADKLKDPGFIVFAACVVGSSLLLIFAVAPRF
GQKNVLVYILICSVVGSLSVSCAKGLGIGIKELFAGEAVLKHPLFWSLLICLVICLSVQI
NYLNKALDIFNTSIVTPIYYVFFTTSVMTCSAILFKEWLNMSVDGIVGTLSGFFTIVLGI
FLLHAFKDIPFTWDSLPVFIRKG
NT seq 969 nt   +upstreamnt  +downstreamnt
atggaggtgaatcgtctagacttctacattggtctcgccttggccgtgagctccagcgtg
tttatcggagcgagttttatcctgaaaaagaaaggcctcctgcgattggcccgcaaagga
tcgacccgagcaggtcaaggcggccatgcgtacctgaaggaatggctgtggtgggcagga
ctcatttcaagcaatttgtcatttgtttgtatttcagtgggaatcggagaggctgctaac
ttcgctgcctacatatttgcccctgccaccttggttactcctcttggtgccctgagtgta
cttgtaagcgccgtgttctcctcctatttcctaaacgagaggctgaacatacacggaaaa
gtgggttgtttgctgagcatcctgggctccacggtgatggtgattcatgccccccaggag
gaggaggtcgggtccctggacgcgatggcggacaagctgaaagacccaggtttcatcgtg
tttgccgcgtgcgttgtggggagcagcctgcttcttatctttgccgtggctccgcggttt
gggcagaagaatgtgctggtctacatcctgatctgctctgtcgtgggctccctctccgtg
tcctgtgccaagggcctggggattggcatcaaggagcttttcgctggcgaggccgttctg
aagcacccgcttttctggtcgttgctcatctgcctggtgatctgcctcagcgttcagatc
aactacctgaacaaggcgctcgacatctttaacacatccatcgtcacccccatctattat
gtcttcttcaccacctccgtcatgacctgctccgccatcctgttcaaagagtggctgaac
atgtccgtggatggcatcgtgggaacgctcagcggcttctttaccatcgttctggggatc
ttcctcctccacgctttcaaagacattccatttacctgggattctctcccagtcttcatt
aggaagggg

DBGET integrated database retrieval system