Thioalkalivibrio nitratireducens: TVNIR_1582 Help Entry TVNIR_1582        CDS       T02408                                  Symbol acpP_[H] Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism tni  Thioalkalivibrio nitratireducens Pathway tni01100   Metabolic pathways tni01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tni00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     TVNIR_1582 (acpP_[H])    00074 Mycolic acid biosynthesis     TVNIR_1582 (acpP_[H])   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     TVNIR_1582 (acpP_[H]) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 HLH DUF1896 Motif Other DBs NCBI-ProteinID:  AGA33248 UniProt:  L0DW42 LinkDB All DBs Position 1574180..1574419 Genome browser AA seq 79 aa AA seqDB search MSSIEERVKKIVVEQLGAKEEDVTDSASFVEDLGADSLDTVELVMALEEEFETEIPDEQA EKITTVQQAIDYIKAHMKD NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcagcattgaagaacgcgtcaagaagatcgtggttgagcaattgggcgccaaggaa gaggacgttacggattccgcctctttcgtcgaggatctgggtgccgactcgctcgacacc gtggagctggtgatggcgctcgaggaggagttcgagacggaaatcccggacgaacaggcc gagaagatcacgaccgtgcagcaggcgatcgactacatcaaggcgcacatgaaggactga

DBGET integrated database retrieval system