Thioalkalivibrio nitratireducens: TVNIR_3117
Help
Entry
TVNIR_3117 CDS
T02408
Symbol
nuoJ_[H]
Name
(GenBank) NADH-ubiquinone oxidoreductase chain J
KO
K00339
NADH-quinone oxidoreductase subunit J [EC:
7.1.1.2
]
Organism
tni
Thioalkalivibrio nitratireducens
Pathway
tni00190
Oxidative phosphorylation
tni01100
Metabolic pathways
Module
tni_M00144
NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:
tni00001
]
09100 Metabolism
09102 Energy metabolism
00190 Oxidative phosphorylation
TVNIR_3117 (nuoJ_[H])
Enzymes [BR:
tni01000
]
7. Translocases
7.1 Catalysing the translocation of protons
7.1.1 Linked to oxidoreductase reactions
7.1.1.2 NADH:ubiquinone reductase (H+-translocating)
TVNIR_3117 (nuoJ_[H])
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Oxidored_q3
DUF6057
ArAE_2_N
TrbK
Motif
Other DBs
NCBI-ProteinID:
AGA34754
UniProt:
L0DYT6
LinkDB
All DBs
Position
complement(3222726..3223370)
Genome browser
AA seq
214 aa
AA seq
DB search
MTFELFLFYVFGAILLGSALALISVRNPVHAALFLVLCFVTAAAIWLMAEAEFLAIVLVL
VYVGAVMVLFLFVVMMLDINLARLRAGFTEYLPAGLVVAAAMATVLTLVITRFITMDPPE
RAGPDYANTLELGRILYTDYVYAFEIAAAILLVAIIAAIALAMRRRPDTKYVDPAGQVRV
RRADRVRLVSMRSEPRRSGAEHDESEHGRNNEGA
NT seq
645 nt
NT seq
+upstream
nt +downstream
nt
atgacctttgaactgtttcttttctacgtgttcggcgcgatcctgctcggctccgcgctg
gctttgatcagcgtgcgcaacccggtgcacgcggcgctgttcctggtgctgtgcttcgtg
accgccgcagcgatctggctaatggccgaggccgagttcctggcgatcgtgctggtgctc
gtctacgtcggcgcggtgatggtgctgttcctgttcgtggtgatgatgctggacatcaac
cttgcccggctgcgcgcgggcttcaccgagtacctgccggccgggttggtcgtggccgcg
gcaatggcgacggtgctgacgctggtgatcacccggttcatcaccatggacccgccggag
cgtgccgggccggactacgcgaacacgctcgagctggggcggatcctgtacaccgattac
gtctacgcgttcgagatcgcggcggcgatcctgttggtcgcgatcatcgcggcgatcgcg
ctggccatgcgccgccgcccggacacgaaatacgtcgatccggccgggcaggtccgcgtg
cgcagggccgaccgggtgcgtctggtctcgatgcgctccgagccgaggaggtcgggtgcc
gagcacgacgagagcgaacacggcaggaacaacgagggcgcctag
DBGET
integrated database retrieval system