Trichoplusia ni (cabbage looper): 113493415 Help Entry 113493415         CDS       T05757                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism tnl  Trichoplusia ni (cabbage looper) Pathway tnl04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:tnl00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     113493415  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:tnl04121]     113493415    03400 DNA repair and recombination proteins [BR:tnl03400]     113493415 Ubiquitin system [BR:tnl04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      113493415    Cul5 complex      113493415 DNA repair and recombination proteins [BR:tnl03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      113493415 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  113493415 NCBI-ProteinID:  XP_026727189 UniProt:  A0A7E5VFX1 LinkDB All DBs Position 4:complement(18319472..18327464) Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRKKLTIFTDAKDTTTVLELKKMIEGILKVSPPSQMLFNKDSQLMEDEKTLAE YGLTSATAKAQCPAPIGLALRKENGEFEALDLTPYSSPPDLPDVMKSQETNGQEQMDQH NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggatgtctttttaatgattaggcgaaaaaaattaaccatcttcactgacgcgaaggac acgacaactgtgctagaattgaagaaaatgatcgaaggtatcttgaaggtgtccccgcca agtcagatgctgttcaacaaggacagccagctcatggaggatgagaagaccttggccgag tatgggctgacgtccgccaccgccaaggcccaatgtcccgcacctatcggattggcttta aggaaggaaaatggtgaatttgaggctttggatctgaccccgtactcttcgccaccggat ttgccagatgtgatgaaatcacaggaaaccaacggacaagaacaaatggatcaacactaa

DBGET integrated database retrieval system