Trichoplusia ni (cabbage looper): 113497883 Help Entry 113497883         CDS       T05757                                  Name (RefSeq) insulin-related peptide 2-like   KO K05459   insulin-like growth factor 1 Organism tnl  Trichoplusia ni (cabbage looper) Pathway tnl04068   FoxO signaling pathway tnl04081   Hormone signaling tnl04150   mTOR signaling pathway tnl04213   Longevity regulating pathway - multiple species Brite KEGG Orthology (KO) [BR:tnl00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     113497883    04150 mTOR signaling pathway     113497883   09133 Signaling molecules and interaction    04081 Hormone signaling     113497883  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     113497883  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tnl04052]     113497883 Cytokines and neuropeptides [BR:tnl04052]  Cytokines   Growth factors (RTK binding)    113497883 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta DUF945 Motif Other DBs NCBI-GeneID:  113497883 NCBI-ProteinID:  XP_026733453 UniProt:  A0A7E5VYN5 LinkDB All DBs Position 10:12726169..12727529 Genome browser AA seq 86 aa AA seqDB search MMKLVVVVVAVVACAWLSAAQSGVSVYCGRQLSERLSSLCWGEPEQKRGWWVPPAGALAG VRGKRGLVDECCDKPCSIEELLTYCF NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgatgaagttagtggttgtggtagtagctgtggtggcgtgtgcgtggctgagcgcggcg cagagcggcgtgagcgtgtactgcgggcggcagctgtcggagcggctgagcagcctgtgc tggggcgagccggagcagaagcgcggctggtgggtgccgccggcgggcgcgctggccggc gtgcggggcaagcgcggcctcgtcgacgagtgctgcgacaagccctgctccatcgaagaa ctcttgacctactgcttctag

DBGET integrated database retrieval system