Trichoplusia ni (cabbage looper): 113506669 Help Entry 113506669         CDS       T05757                                  Name (RefSeq) CD63 antigen-like   KO K06497   CD63 antigen Organism tnl  Trichoplusia ni (cabbage looper) Pathway tnl03272   Virion - Hepatitis viruses tnl04142   Lysosome Brite KEGG Orthology (KO) [BR:tnl00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     113506669  09140 Cellular Processes   09141 Transport and catabolism    04142 Lysosome     113506669  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tnl04147]     113506669    04090 CD molecules [BR:tnl04090]     113506669 Exosome [BR:tnl04147]  Exosomal proteins   Proteins found in most exosomes    113506669 CD molecules [BR:tnl04090]  Proteins   113506669 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tetraspanin Motif Other DBs NCBI-GeneID:  113506669 NCBI-ProteinID:  XP_026745301 UniProt:  A0A7E5WYP2 LinkDB All DBs Position 22 Genome browser AA seq 133 aa AA seqDB search MKHQDLENSILAHLNGTIKEYDTNKDVAKTFDIVQTDFKCCGINGPDDWKANNISMPATC CSGQEITGGVPAPCTPLSDHFHKEGCLDKLVQYFKDTALVLGGVGIGVAIVQLLGVIFAC CLARSIRSQYETV NT seq 402 nt NT seq  +upstreamnt  +downstreamnt atgaagcaccaggacctggagaactcgatactggctcacctgaacggcaccatcaaggag tacgacaccaacaaggacgtcgccaaaacattcgacatcgtacagactgacttcaaatgt tgcggtatcaacggccccgatgactggaaagccaacaacatctcgatgccggcgacctgc tgctcgggtcaggagatcactggcggcgtgcccgcgccttgcactccgctctccgaccac ttccacaaggagggctgcctcgacaaactcgtccagtacttcaaggacaccgcccttgta ctcggcggtgttggcataggagttgctatagtgcagctgcttggtgtcatattcgcttgc tgtctcgctcgctccatccgcagtcagtacgagaccgtataa

DBGET integrated database retrieval system