Thermotoga petrophila RKU-10: Tnap_0879 Help Entry Tnap_0879         CDS       T01139                                  Name (GenBank) Fe-S cluster domain protein   KO K03616   H+/Na+-translocating ferredoxin:NAD+ oxidoreductase subunit B [EC:7.1.1.11 7.2.1.2] Organism tnp  Thermotoga petrophila RKU-10 Brite KEGG Orthology (KO) [BR:tnp00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     Tnap_0879 Enzymes [BR:tnp01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.11  ferredoxin---NAD+ oxidoreductase (H+-transporting)      Tnap_0879   7.2  Catalysing the translocation of inorganic cations    7.2.1  Linked to oxidoreductase reactions     7.2.1.2  ferredoxin---NAD+ oxidoreductase (Na+-transporting)      Tnap_0879 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FeS Motif Other DBs NCBI-ProteinID:  ADA66970 UniProt:  D2C7N4 LinkDB All DBs Position 913976..914269 Genome browser AA seq 97 aa AA seqDB search MEVIYSTLLLAVLGFGFGAFLAYSAQKFKVEEDPRVKMITGVLPGINCGACGFAGCEAYA KAIVKGQAETNRCLPGRPQGVEEKIKKILEEYKNVSS NT seq 294 nt NT seq  +upstreamnt  +downstreamnt ttggaagtcatctactcgacgctcttgctcgccgttctgggttttggattcggggctttt cttgcctattctgcgcagaaattcaaggtggaagaagatccacgtgtgaagatgataaca ggggttcttcctggaataaactgtggtgcgtgcggttttgccggttgtgaggcttacgcg aaggcgatcgtgaaaggtcaggcagaaacgaacaggtgcctccccggaagacctcagggc gtcgaagagaagataaagaagatcctcgaggagtacaagaatgtctcctcttga

DBGET integrated database retrieval system