KEGG   Thermodesulfobium narugense: Thena_0520
Entry
Thena_0520        CDS       T01488                                 
Name
(GenBank) ribosomal protein L18
  KO
K02881  large subunit ribosomal protein L18
Organism
tnr  Thermodesulfobium narugense
Pathway
tnr03010  Ribosome
Brite
KEGG Orthology (KO) [BR:tnr00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Thena_0520
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:tnr03011]
    Thena_0520
Ribosome [BR:tnr03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Thena_0520
  Bacteria
    Thena_0520
  Archaea
    Thena_0520
SSDB
Motif
Pfam: Ribosomal_L18p
Other DBs
NCBI-ProteinID: AEE14160
UniProt: M1E6S4
LinkDB
Position
512419..512784
AA seq 121 aa
MIKEKTRLEGRKIRQKRTRKKVFGTKDRPRLSIFRSLNHIYAQIIDDTEGKTLAHASSLD
PEIRNSLSGSKKDKSKAVGALIAKRALEKGIDKVVFDRAGYKYHGRVAMLAEAAREAGLK
F
NT seq 366 nt   +upstreamnt  +downstreamnt
gtgataaaagagaaaacaagattagaaggcagaaaaataagacaaaagagaactagaaaa
aaggttttcggtactaaggatagacctagattgtctatttttaggagtttaaatcatatt
tatgcacagattattgatgatacagagggtaaaactcttgcacatgcatcttcattggac
cctgagatcagaaattctttatctggcagcaagaaagataaatcaaaagcggttggtgct
cttattgccaaaagagctttagagaaaggaatagataaagtagtttttgatagagcaggg
tataaatatcatggccgcgttgcaatgcttgctgaagctgcaagagaagcaggattaaag
ttctaa

DBGET integrated database retrieval system