Thermococcus nautili: BD01_1509 Help Entry BD01_1509         CDS       T03065                                  Name (GenBank) Ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism tnu  Thermococcus nautili Pathway tnu03010   Ribosome Brite KEGG Orthology (KO) [BR:tnu00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     BD01_1509   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     BD01_1509  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:tnu03011]     BD01_1509    04121 Ubiquitin system [BR:tnu04121]     BD01_1509   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tnu04147]     BD01_1509 Ribosome [BR:tnu03011]  Ribosomal proteins   Eukaryotes    Small subunit     BD01_1509   Archaea     BD01_1509 Ubiquitin system [BR:tnu04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    BD01_1509 Exosome [BR:tnu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    BD01_1509   Exosomal proteins of colorectal cancer cells    BD01_1509 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Cas12f1-like_TNB Zn_ribbon_IS1595 Zn_ribbon_RPB9 Ribosomal_L37e GFA Zn_ribbon_NUD MqsA_antitoxin Zn_ribbon_Nudix Zn_Ribbon_1 Motif Other DBs NCBI-ProteinID:  AHL23117 UniProt:  W8NVA2 LinkDB All DBs Position 1327585..1327758 Genome browser AA seq 57 aa AA seqDB search MAKGKKKTSQKWKLYEVKGGKVVRKNKFCPRCGPGVFMANHKDRWSCGRCGYTEWKK NT seq 174 nt NT seq  +upstreamnt  +downstreamnt atggccaagggcaagaagaagaccagccagaagtggaagctctacgaggttaagggtgga aaggtcgtcaggaagaacaagttctgcccgcgctgcgggccgggcgttttcatggccaac cacaaggaccgctggtcctgcggaaggtgcggctacaccgagtggaagaagtga

DBGET integrated database retrieval system