Thermodesulfovibrio obliviosus: V4D31_02205 Help Entry V4D31_02205       CDS       T10572                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism tob  Thermodesulfovibrio obliviosus Brite KEGG Orthology (KO) [BR:tob00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:tob03032]     V4D31_02205    03036 Chromosome and associated proteins [BR:tob03036]     V4D31_02205    03400 DNA repair and recombination proteins [BR:tob03400]     V4D31_02205 DNA replication proteins [BR:tob03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     V4D31_02205 Chromosome and associated proteins [BR:tob03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     V4D31_02205 DNA repair and recombination proteins [BR:tob03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       V4D31_02205 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 HU-CCDC81_euk_1 ALF HU-CCDC81_bac_1 DUF2267 Motif Other DBs NCBI-ProteinID:  XCH48982 UniProt:  A0AAU8H2H5 LinkDB All DBs Position 446736..447008 Genome browser AA seq 90 aa AA seqDB search MTKAELVSKIAGKAELTKAEAAKALDATIDAIKEALKKGDKVTLVGFGSFYVSKRKARKG RNPRTGQEIKIPATKVPKFTAGKSLKEAVK NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgacaaaggcagaattagtaagcaaaattgcagggaaggcagagcttacaaaggctgag gcagcgaaggcactggatgctacaattgatgcgattaaagaagctctcaaaaaaggcgac aaggttacattagtaggttttggcagcttctatgtttcaaagagaaaggcaagaaaggga agaaatccaagaactggacaggaaattaagattcctgcaacaaaagttcctaaatttaca gcaggaaaatctttgaaagaagcagtaaagtaa

DBGET integrated database retrieval system