Thermodesulfovibrio obliviosus: V4D31_05370 Help Entry V4D31_05370       CDS       T10572                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism tob  Thermodesulfovibrio obliviosus Pathway tob00020   Citrate cycle (TCA cycle) tob00720   Other carbon fixation pathways tob01100   Metabolic pathways tob01110   Biosynthesis of secondary metabolites tob01120   Microbial metabolism in diverse environments tob01200   Carbon metabolism tob01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:tob00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     V4D31_05370   09102 Energy metabolism    00720 Other carbon fixation pathways     V4D31_05370 Enzymes [BR:tob01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      V4D31_05370 SSDB OrthologParalogGFIT Motif Pfam:  Fer4_6 Fer4_2 Fer4 Fer4_21 Fer4_7 Fer4_10 LdpA_Fe-S-bd Fer4_9 Fer4_4 Fer4_15 Fer4_16 Fer4_13 Fer4_22 Fer4_3 Fer4_8 Fer4_17 Motif Other DBs NCBI-ProteinID:  XCH47783 UniProt:  A0AAU8H1T8 LinkDB All DBs Position complement(1079753..1079980) Genome browser AA seq 75 aa AA seqDB search MQTKVKKGLIVIDSERCKGCKYCILTCPKGCIEILSEFNSSGYFPAKFSNPESCIGCAMC AVVCPEIAIEVFVED NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgcaaacaaaggttaaaaaaggtttaatcgttattgattcagaaagatgtaaaggctgt aaatactgcattttaacatgtcctaagggatgcattgaaatattatcagagtttaattcc tcaggttatttccctgccaaattttcaaaccctgaaagttgcataggatgtgcaatgtgc gcagttgtttgccctgaaatagccatagaagtattcgtagaagattga

DBGET integrated database retrieval system