Talpa occidentalis (Iberian mole): 119230731 Help Entry 119230731         CDS       T07495                                  Symbol CCL27 Name (RefSeq) C-C motif chemokine 27   KO K16598   C-C motif chemokine 27 Organism tod  Talpa occidentalis (Iberian mole) Pathway tod04060   Cytokine-cytokine receptor interaction tod04061   Viral protein interaction with cytokine and cytokine receptor tod04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:tod00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     119230731 (CCL27)    04061 Viral protein interaction with cytokine and cytokine receptor     119230731 (CCL27)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     119230731 (CCL27)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tod04052]     119230731 (CCL27) Cytokines and neuropeptides [BR:tod04052]  Cytokines   Chemokines    119230731 (CCL27) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 VMAP-M1 Motif Other DBs NCBI-GeneID:  119230731 NCBI-ProteinID:  XP_037348069 LinkDB All DBs Position Unknown AA seq 102 aa AA seqDB search MKGLSPTNSLLMLLLLLSPDHGEELPLPSSTNCCTQLYRQPLPNKLLRKVIRVEVQEANG ECHLQAFVLHLSRRSVCIHPQNGSLARWLERQGKRFRGTLPI NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atgaagggactctcacctaccaacagcctcctgatgctactgttgctcctgagcccagac catggagaagaattgccactgccttccagcactaactgctgcactcagctctaccgacag cctctgccaaataagctgctgaggaaagttatccgggtggaagtacaggaggctaatggg gaatgccaccttcaggcctttgtacttcacctgtctcggcgcagcgtctgcatccacccc cagaacggcagcttagccaggtggcttgagcgccaagggaagaggttccgggggactctg cccatatga

DBGET integrated database retrieval system