Talpa occidentalis (Iberian mole): 119230780 Help Entry 119230780         CDS       T07495                                  Symbol PFN1 Name (RefSeq) profilin-1   KO K05759   profilin Organism tod  Talpa occidentalis (Iberian mole) Pathway tod04015   Rap1 signaling pathway tod04810   Regulation of actin cytoskeleton tod05014   Amyotrophic lateral sclerosis tod05132   Salmonella infection Brite KEGG Orthology (KO) [BR:tod00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     119230780 (PFN1)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     119230780 (PFN1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     119230780 (PFN1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     119230780 (PFN1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tod04131]     119230780 (PFN1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:tod04812]     119230780 (PFN1)    04147 Exosome [BR:tod04147]     119230780 (PFN1) Membrane trafficking [BR:tod04131]  Others   Actin-binding proteins    Others     119230780 (PFN1) Cytoskeleton proteins [BR:tod04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      119230780 (PFN1) Exosome [BR:tod04147]  Exosomal proteins   Proteins found in most exosomes    119230780 (PFN1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  119230780 NCBI-ProteinID:  XP_037348181 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWASVPGKTFGNITPAEVGVLVGKDRSSFF VNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNITVTMTAKTLVLLMGKEGVH GGMINKKCYEMASHLRRSQY NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccgggtggaacgcctatatcgacaacctcatggcggacgggacctgtcaggacgcg gccatcgtgggctataaggactcgccctctgtctgggcctccgtgcccgggaaaaccttc ggcaacatcacgccagctgaggttggtgtcttggttggcaaagaccggtcaagttttttc gtgaatgggctgacacttgggggccagaaatgttctgtgatccgggactcactgctgcag gatggggaatttaccatggatcttcgcaccaagagcactggtggagcccccaccttcaac atcactgtcaccatgactgccaagacgctagtcctgctgatgggtaaagaaggtgtccac ggtggtatgatcaacaagaaatgttatgaaatggcctctcacctgcggcgttcccagtac tga

DBGET integrated database retrieval system