Talpa occidentalis (Iberian mole): 119230853 Help Entry 119230853         CDS       T07495                                  Name (RefSeq) C-C motif chemokine 2-like   KO K14624   C-C motif chemokine 2 Organism tod  Talpa occidentalis (Iberian mole) Pathway tod04060   Cytokine-cytokine receptor interaction tod04061   Viral protein interaction with cytokine and cytokine receptor tod04062   Chemokine signaling pathway tod04621   NOD-like receptor signaling pathway tod04657   IL-17 signaling pathway tod04668   TNF signaling pathway tod04933   AGE-RAGE signaling pathway in diabetic complications tod05135   Yersinia infection tod05142   Chagas disease tod05144   Malaria tod05163   Human cytomegalovirus infection tod05164   Influenza A tod05168   Herpes simplex virus 1 infection tod05171   Coronavirus disease tod05323   Rheumatoid arthritis tod05417   Lipid and atherosclerosis tod05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:tod00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     119230853   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     119230853    04061 Viral protein interaction with cytokine and cytokine receptor     119230853  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     119230853    04657 IL-17 signaling pathway     119230853    04062 Chemokine signaling pathway     119230853  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease     119230853    05164 Influenza A     119230853    05168 Herpes simplex virus 1 infection     119230853    05163 Human cytomegalovirus infection     119230853   09171 Infectious disease: bacterial    05135 Yersinia infection     119230853   09174 Infectious disease: parasitic    05144 Malaria     119230853    05142 Chagas disease     119230853   09163 Immune disease    05323 Rheumatoid arthritis     119230853   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     119230853    05418 Fluid shear stress and atherosclerosis     119230853   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     119230853  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tod04052]     119230853    00536 Glycosaminoglycan binding proteins [BR:tod00536]     119230853 Cytokines and neuropeptides [BR:tod04052]  Cytokines   Chemokines    119230853 Glycosaminoglycan binding proteins [BR:tod00536]  Heparan sulfate / Heparin   Chemokines    119230853 SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  119230853 NCBI-ProteinID:  XP_037348279 LinkDB All DBs Position Unknown AA seq 98 aa AA seqDB search MKASATLLCLLLTAAALSTQLLAQPVGISRNTCCYDFTSKKIPKLKLVSYVRITSSQCPK EAVIFKTRRGKEICANPEHDWVLDSINHLDKKTQTLKP NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgaaggcctccgcaaccctcctgtgcctgctgctcacagctgctgccctcagcacccag ctgctcgcccagccagttggaataagtagaaacacctgctgctatgatttcactagcaag aagatcccgaagctgaagctggtgagctatgtcagaatcaccagcagccagtgtcccaag gaagctgtgatattcaagaccagacggggcaaggagatctgtgctaaccccgagcatgat tgggtcctggattccataaatcacctggacaagaaaacccaaactctgaagccttga

DBGET integrated database retrieval system