Talpa occidentalis (Iberian mole): 119231112 Help Entry 119231112         CDS       T07495                                  Symbol TXN Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism tod  Talpa occidentalis (Iberian mole) Pathway tod04621   NOD-like receptor signaling pathway tod05012   Parkinson disease tod05132   Salmonella infection tod05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:tod00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     119231112 (TXN)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     119231112 (TXN)   09164 Neurodegenerative disease    05012 Parkinson disease     119231112 (TXN)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     119231112 (TXN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:tod03110]     119231112 (TXN) Chaperones and folding catalysts [BR:tod03110]  Protein folding catalysts   Protein disulfide isomerase    119231112 (TXN) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 OST3_OST6 DIM1 Thioredoxin_2 AhpC-TSA Thioredoxin_7 Thioredoxin_9 Glutaredoxin Redoxin Motif Other DBs NCBI-GeneID:  119231112 NCBI-ProteinID:  XP_037348662 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MVKQIDSKVAFQDALNGAGDKLVVVDFSATWCGPCKMIKPFFHALSEKYTNVVFLEVDVD DCQDVASDCEVKCMPTFQFFKKGQKVGEFSGANKDKLEATINELI NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtgaagcagattgacagcaaggttgcttttcaggacgccttgaatggtgcaggagat aaactcgtagtcgttgacttctcggccacgtggtgtgggccttgcaaaatgatcaagcct ttctttcatgccctctctgaaaagtacaccaatgtggtgttccttgaagttgatgtggat gactgtcaggatgtcgcttcagattgtgaagtcaaatgcatgccaaccttccagtttttt aaaaagggacaaaaggtgggtgaattttctggagcaaataaggacaaacttgaagctacc attaatgaattaatctaa

DBGET integrated database retrieval system