Talpa occidentalis (Iberian mole): 119231203 Help Entry 119231203         CDS       T07495                                  Symbol PPP3R2 Name (RefSeq) calcineurin subunit B type 2   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism tod  Talpa occidentalis (Iberian mole) Pathway tod04010   MAPK signaling pathway tod04020   Calcium signaling pathway tod04022   cGMP-PKG signaling pathway tod04114   Oocyte meiosis tod04218   Cellular senescence tod04310   Wnt signaling pathway tod04360   Axon guidance tod04370   VEGF signaling pathway tod04380   Osteoclast differentiation tod04625   C-type lectin receptor signaling pathway tod04650   Natural killer cell mediated cytotoxicity tod04658   Th1 and Th2 cell differentiation tod04659   Th17 cell differentiation tod04660   T cell receptor signaling pathway tod04662   B cell receptor signaling pathway tod04720   Long-term potentiation tod04724   Glutamatergic synapse tod04921   Oxytocin signaling pathway tod04922   Glucagon signaling pathway tod04924   Renin secretion tod05010   Alzheimer disease tod05014   Amyotrophic lateral sclerosis tod05020   Prion disease tod05022   Pathways of neurodegeneration - multiple diseases tod05031   Amphetamine addiction tod05152   Tuberculosis tod05163   Human cytomegalovirus infection tod05166   Human T-cell leukemia virus 1 infection tod05167   Kaposi sarcoma-associated herpesvirus infection tod05170   Human immunodeficiency virus 1 infection tod05235   PD-L1 expression and PD-1 checkpoint pathway in cancer tod05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:tod00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     119231203 (PPP3R2)    04310 Wnt signaling pathway     119231203 (PPP3R2)    04370 VEGF signaling pathway     119231203 (PPP3R2)    04020 Calcium signaling pathway     119231203 (PPP3R2)    04022 cGMP-PKG signaling pathway     119231203 (PPP3R2)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     119231203 (PPP3R2)    04218 Cellular senescence     119231203 (PPP3R2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     119231203 (PPP3R2)    04650 Natural killer cell mediated cytotoxicity     119231203 (PPP3R2)    04660 T cell receptor signaling pathway     119231203 (PPP3R2)    04658 Th1 and Th2 cell differentiation     119231203 (PPP3R2)    04659 Th17 cell differentiation     119231203 (PPP3R2)    04662 B cell receptor signaling pathway     119231203 (PPP3R2)   09152 Endocrine system    04922 Glucagon signaling pathway     119231203 (PPP3R2)    04921 Oxytocin signaling pathway     119231203 (PPP3R2)    04924 Renin secretion     119231203 (PPP3R2)   09156 Nervous system    04724 Glutamatergic synapse     119231203 (PPP3R2)    04720 Long-term potentiation     119231203 (PPP3R2)   09158 Development and regeneration    04360 Axon guidance     119231203 (PPP3R2)    04380 Osteoclast differentiation     119231203 (PPP3R2)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     119231203 (PPP3R2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     119231203 (PPP3R2)    05170 Human immunodeficiency virus 1 infection     119231203 (PPP3R2)    05163 Human cytomegalovirus infection     119231203 (PPP3R2)    05167 Kaposi sarcoma-associated herpesvirus infection     119231203 (PPP3R2)   09171 Infectious disease: bacterial    05152 Tuberculosis     119231203 (PPP3R2)   09164 Neurodegenerative disease    05010 Alzheimer disease     119231203 (PPP3R2)    05014 Amyotrophic lateral sclerosis     119231203 (PPP3R2)    05020 Prion disease     119231203 (PPP3R2)    05022 Pathways of neurodegeneration - multiple diseases     119231203 (PPP3R2)   09165 Substance dependence    05031 Amphetamine addiction     119231203 (PPP3R2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     119231203 (PPP3R2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:tod01009]     119231203 (PPP3R2) Protein phosphatases and associated proteins [BR:tod01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      119231203 (PPP3R2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_9 YtfJ_HI0045 Motif Other DBs NCBI-GeneID:  119231203 NCBI-ProteinID:  XP_037348774 LinkDB All DBs Position Unknown AA seq 170 aa AA seqDB search MGNEASYPAQMCSHFDRDEVRCLCKKFKKLDLDHSGTVSLQEFMALPQLQHNPLVQRVVD IFDIDGNGEVDLKEFIWGTSQFSVKGDEQQKLRFAFSIYDMDKDGFISNGELFQVLKMMV GTNLTDWNLQQLVDKTIIILDRDGDGKISFEEFSAVVKHLEIHKKMALIM NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atggggaatgaggccagttacccagcacagatgtgctctcactttgaccgcgatgaagtt agatgtctgtgcaagaagtttaagaagctggacttggaccattcaggcacagtgagcttg caggaattcatggccctcccccagctgcagcacaacccgttggtgcagcgagtagtcgac atctttgacatcgacggcaatggcgaagtggacttaaaggagttcatctggggtacctcc cagttcagtgtcaagggagacgagcagcagaaattgaggtttgctttcagcatctatgac atggataaagacggcttcatctccaacggggagctcttccaggtgctgaagatgatggtg gggaccaacctgaccgattggaatttacagcagctcgtggacaaaaccatcatcatcctg gatagagacggtgatgggaaaatatccttcgaggaattcagtgccgtggtcaaacacctg gagatccacaagaagatggccttaattatgtga

DBGET integrated database retrieval system