Talpa occidentalis (Iberian mole): 119232446 Help Entry 119232446         CDS       T07495                                  Name (RefSeq) histone H2A.N   KO K11252   histone H2B Organism tod  Talpa occidentalis (Iberian mole) Pathway tod04613   Neutrophil extracellular trap formation tod05034   Alcoholism tod05203   Viral carcinogenesis tod05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:tod00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     119232446  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     119232446   09163 Immune disease    05322 Systemic lupus erythematosus     119232446   09165 Substance dependence    05034 Alcoholism     119232446  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tod03036]     119232446   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tod04147]     119232446 Chromosome and associated proteins [BR:tod03036]  Eukaryotic type   Nucleosome assembly factors    Histones     119232446 Exosome [BR:tod04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    119232446 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone Motif Other DBs NCBI-GeneID:  119232446 NCBI-ProteinID:  XP_037350356 LinkDB All DBs Position Unknown AA seq 114 aa AA seqDB search MYFICLHGLRTPKKKTKIHIPVKKKHKCVSSAFGKKRWKKKEAYFVYMGRLLKQVHPDFS GCSWVLAVLCSLEVWLLEQVSLEAVRLSFHYHRRAVTSREILEAVKQRASWKSF NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atgtacttcatttgcttacatggcctaagaacccctaagaagaagactaaaattcacatc ccagtgaaaaagaaacacaagtgtgtcagctcagcctttgggaagaaaagatggaagaag aaggaggcctattttgtttacatggggagactgctaaagcaagtccacccggacttcagc gggtgctcctgggtcttggctgtgctgtgctctctggaggtctggctgctggagcaggtg agcctggaggcagttaggctgtccttccactaccacagaagagccgtcaccagcagagag atcctcgaagcagtcaagcagagagcctcttggaagagcttttga

DBGET integrated database retrieval system