Talpa occidentalis (Iberian mole): 119232539 Help Entry 119232539         CDS       T07495                                  Name (RefSeq) interferon alpha-6-like   KO K05414   interferon alpha Organism tod  Talpa occidentalis (Iberian mole) Pathway tod04060   Cytokine-cytokine receptor interaction tod04151   PI3K-Akt signaling pathway tod04217   Necroptosis tod04620   Toll-like receptor signaling pathway tod04621   NOD-like receptor signaling pathway tod04622   RIG-I-like receptor signaling pathway tod04623   Cytosolic DNA-sensing pathway tod04630   JAK-STAT signaling pathway tod04650   Natural killer cell mediated cytotoxicity tod04936   Alcoholic liver disease tod05152   Tuberculosis tod05160   Hepatitis C tod05161   Hepatitis B tod05162   Measles tod05163   Human cytomegalovirus infection tod05164   Influenza A tod05165   Human papillomavirus infection tod05167   Kaposi sarcoma-associated herpesvirus infection tod05168   Herpes simplex virus 1 infection tod05169   Epstein-Barr virus infection tod05170   Human immunodeficiency virus 1 infection tod05171   Coronavirus disease - COVID-19 tod05200   Pathways in cancer tod05320   Autoimmune thyroid disease tod05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:tod00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     119232539    04151 PI3K-Akt signaling pathway     119232539   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     119232539  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     119232539  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     119232539    04621 NOD-like receptor signaling pathway     119232539    04622 RIG-I-like receptor signaling pathway     119232539    04623 Cytosolic DNA-sensing pathway     119232539    04650 Natural killer cell mediated cytotoxicity     119232539  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     119232539   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     119232539    05161 Hepatitis B     119232539    05160 Hepatitis C     119232539    05171 Coronavirus disease - COVID-19     119232539    05164 Influenza A     119232539    05162 Measles     119232539    05168 Herpes simplex virus 1 infection     119232539    05163 Human cytomegalovirus infection     119232539    05167 Kaposi sarcoma-associated herpesvirus infection     119232539    05169 Epstein-Barr virus infection     119232539    05165 Human papillomavirus infection     119232539   09171 Infectious disease: bacterial    05152 Tuberculosis     119232539   09163 Immune disease    05320 Autoimmune thyroid disease     119232539   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     119232539   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     119232539  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tod04052]     119232539 Cytokines and neuropeptides [BR:tod04052]  Cytokines   Interferons    119232539 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon iSTAND Motif Other DBs NCBI-GeneID:  119232539 NCBI-ProteinID:  XP_037350482 LinkDB All DBs Position Unknown AA seq 185 aa AA seqDB search MVSPLCLLLALVLLYHRPASSLDCDLPPRHGGPETFILVNQMGRLSLLSCLEFRKDFQFP QTLVDGSRLEKTQARVVVQEMLQEVFSLFSTNDSFEAWEETVLDKFLIELYQQLEDLEKC LEKEWKVGLSALGSEDTTLAVKRYFQGIRLYLKEKEYSSCAWEIVRVEIRRCLFSINKLI RKPRK NT seq 558 nt NT seq  +upstreamnt  +downstreamnt atggtctccccactctgtctgctgctggctctggtgctgctgtaccaccgccctgccagc tctctggactgcgacctgcctccaaggcatggcggtccagaaaccttcatacttgtaaat cagatggggagactctccctactgtcctgtctggagttcaggaaagacttccaatttcct cagacgctggtggacggtagccggcttgagaagacgcaagcccgggtggtggtgcaggag atgctccaggaggtcttcagccttttcagcacgaatgactcttttgaagcttgggaggag accgtcctggacaaattcctcattgaactttatcagcagctggaggacctggagaaatgt ttggagaaggaatggaaggtgggactgtcagccctgggaagcgaggacaccacattggcg gtgaagcgctacttccagggaatccgtctgtatctgaaagagaaagaatacagcagctgt gcctgggagatcgtcagggtggaaatcagaaggtgcttgttctccattaacaagctgata agaaaacccaggaaataa

DBGET integrated database retrieval system