Talpa occidentalis (Iberian mole): 119233628 Help Entry 119233628         CDS       T07495                                  Symbol IL2 Name (RefSeq) interleukin-2   KO K05429   interleukin 2 Organism tod  Talpa occidentalis (Iberian mole) Pathway tod04060   Cytokine-cytokine receptor interaction tod04061   Viral protein interaction with cytokine and cytokine receptor tod04151   PI3K-Akt signaling pathway tod04625   C-type lectin receptor signaling pathway tod04630   JAK-STAT signaling pathway tod04658   Th1 and Th2 cell differentiation tod04659   Th17 cell differentiation tod04660   T cell receptor signaling pathway tod04672   Intestinal immune network for IgA production tod04940   Type I diabetes mellitus tod05135   Yersinia infection tod05142   Chagas disease tod05162   Measles tod05166   Human T-cell leukemia virus 1 infection tod05171   Coronavirus disease - COVID-19 tod05200   Pathways in cancer tod05320   Autoimmune thyroid disease tod05321   Inflammatory bowel disease tod05330   Allograft rejection tod05332   Graft-versus-host disease Brite KEGG Orthology (KO) [BR:tod00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     119233628 (IL2)    04151 PI3K-Akt signaling pathway     119233628 (IL2)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     119233628 (IL2)    04061 Viral protein interaction with cytokine and cytokine receptor     119233628 (IL2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     119233628 (IL2)    04660 T cell receptor signaling pathway     119233628 (IL2)    04658 Th1 and Th2 cell differentiation     119233628 (IL2)    04659 Th17 cell differentiation     119233628 (IL2)    04672 Intestinal immune network for IgA production     119233628 (IL2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     119233628 (IL2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     119233628 (IL2)    05171 Coronavirus disease - COVID-19     119233628 (IL2)    05162 Measles     119233628 (IL2)   09171 Infectious disease: bacterial    05135 Yersinia infection     119233628 (IL2)   09174 Infectious disease: parasitic    05142 Chagas disease     119233628 (IL2)   09163 Immune disease    05320 Autoimmune thyroid disease     119233628 (IL2)    05321 Inflammatory bowel disease     119233628 (IL2)    05330 Allograft rejection     119233628 (IL2)    05332 Graft-versus-host disease     119233628 (IL2)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     119233628 (IL2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tod04052]     119233628 (IL2)    00536 Glycosaminoglycan binding proteins [BR:tod00536]     119233628 (IL2) Cytokines and neuropeptides [BR:tod04052]  Cytokines   Interleukins    119233628 (IL2) Glycosaminoglycan binding proteins [BR:tod00536]  Heparan sulfate / Heparin   Cytokines    119233628 (IL2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL2 Motif Other DBs NCBI-GeneID:  119233628 NCBI-ProteinID:  XP_037352038 LinkDB All DBs Position Unknown AA seq 93 aa AA seqDB search MLTLPFYVPQEVTEWRHLQCLGEELVHLEEALRFVEDGAGALKELMDNINVTAQALKGAA PSFKCAYGAEVVNVTEFLSTWVGFCQRLFLTAA NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgctcacgctgccgttctacgtgccccaggaggtcacagaatggagacaccttcagtgc ctcggggaggagctggtgcatctggaggaggcgctgcgctttgtggaggacggcgcggga gccctcaaggagctgatggacaacatcaacgtcaccgcccaggcgctgaagggggccgcg ccgagcttcaagtgtgcctacggcgccgaggtggtcaacgtgaccgagttcctgagcacg tgggtcggcttctgccagcgcctattcctgacggcggcctga

DBGET integrated database retrieval system