KEGG   Talpa occidentalis (Iberian mole): 119234388
Entry
119234388         CDS       T07495                                 
Symbol
MAPK1
Name
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
tod  Talpa occidentalis (Iberian mole)
Pathway
tod01521  EGFR tyrosine kinase inhibitor resistance
tod01522  Endocrine resistance
tod01524  Platinum drug resistance
tod04010  MAPK signaling pathway
tod04012  ErbB signaling pathway
tod04014  Ras signaling pathway
tod04015  Rap1 signaling pathway
tod04022  cGMP-PKG signaling pathway
tod04024  cAMP signaling pathway
tod04062  Chemokine signaling pathway
tod04066  HIF-1 signaling pathway
tod04068  FoxO signaling pathway
tod04071  Sphingolipid signaling pathway
tod04072  Phospholipase D signaling pathway
tod04114  Oocyte meiosis
tod04140  Autophagy - animal
tod04148  Efferocytosis
tod04150  mTOR signaling pathway
tod04151  PI3K-Akt signaling pathway
tod04210  Apoptosis
tod04218  Cellular senescence
tod04261  Adrenergic signaling in cardiomyocytes
tod04270  Vascular smooth muscle contraction
tod04350  TGF-beta signaling pathway
tod04360  Axon guidance
tod04370  VEGF signaling pathway
tod04371  Apelin signaling pathway
tod04380  Osteoclast differentiation
tod04510  Focal adhesion
tod04520  Adherens junction
tod04540  Gap junction
tod04550  Signaling pathways regulating pluripotency of stem cells
tod04611  Platelet activation
tod04613  Neutrophil extracellular trap formation
tod04620  Toll-like receptor signaling pathway
tod04621  NOD-like receptor signaling pathway
tod04625  C-type lectin receptor signaling pathway
tod04650  Natural killer cell mediated cytotoxicity
tod04657  IL-17 signaling pathway
tod04658  Th1 and Th2 cell differentiation
tod04659  Th17 cell differentiation
tod04660  T cell receptor signaling pathway
tod04662  B cell receptor signaling pathway
tod04664  Fc epsilon RI signaling pathway
tod04666  Fc gamma R-mediated phagocytosis
tod04668  TNF signaling pathway
tod04713  Circadian entrainment
tod04720  Long-term potentiation
tod04722  Neurotrophin signaling pathway
tod04723  Retrograde endocannabinoid signaling
tod04724  Glutamatergic synapse
tod04725  Cholinergic synapse
tod04726  Serotonergic synapse
tod04730  Long-term depression
tod04810  Regulation of actin cytoskeleton
tod04910  Insulin signaling pathway
tod04912  GnRH signaling pathway
tod04914  Progesterone-mediated oocyte maturation
tod04915  Estrogen signaling pathway
tod04916  Melanogenesis
tod04917  Prolactin signaling pathway
tod04919  Thyroid hormone signaling pathway
tod04921  Oxytocin signaling pathway
tod04926  Relaxin signaling pathway
tod04928  Parathyroid hormone synthesis, secretion and action
tod04929  GnRH secretion
tod04930  Type II diabetes mellitus
tod04933  AGE-RAGE signaling pathway in diabetic complications
tod04934  Cushing syndrome
tod04935  Growth hormone synthesis, secretion and action
tod04960  Aldosterone-regulated sodium reabsorption
tod05010  Alzheimer disease
tod05020  Prion disease
tod05022  Pathways of neurodegeneration - multiple diseases
tod05034  Alcoholism
tod05132  Salmonella infection
tod05133  Pertussis
tod05135  Yersinia infection
tod05140  Leishmaniasis
tod05142  Chagas disease
tod05145  Toxoplasmosis
tod05152  Tuberculosis
tod05160  Hepatitis C
tod05161  Hepatitis B
tod05163  Human cytomegalovirus infection
tod05164  Influenza A
tod05165  Human papillomavirus infection
tod05166  Human T-cell leukemia virus 1 infection
tod05167  Kaposi sarcoma-associated herpesvirus infection
tod05170  Human immunodeficiency virus 1 infection
tod05171  Coronavirus disease - COVID-19
tod05200  Pathways in cancer
tod05203  Viral carcinogenesis
tod05205  Proteoglycans in cancer
tod05206  MicroRNAs in cancer
tod05207  Chemical carcinogenesis - receptor activation
tod05208  Chemical carcinogenesis - reactive oxygen species
tod05210  Colorectal cancer
tod05211  Renal cell carcinoma
tod05212  Pancreatic cancer
tod05213  Endometrial cancer
tod05214  Glioma
tod05215  Prostate cancer
tod05216  Thyroid cancer
tod05218  Melanoma
tod05219  Bladder cancer
tod05220  Chronic myeloid leukemia
tod05221  Acute myeloid leukemia
tod05223  Non-small cell lung cancer
tod05224  Breast cancer
tod05225  Hepatocellular carcinoma
tod05226  Gastric cancer
tod05230  Central carbon metabolism in cancer
tod05231  Choline metabolism in cancer
tod05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
tod05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:tod00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    119234388 (MAPK1)
   04012 ErbB signaling pathway
    119234388 (MAPK1)
   04014 Ras signaling pathway
    119234388 (MAPK1)
   04015 Rap1 signaling pathway
    119234388 (MAPK1)
   04350 TGF-beta signaling pathway
    119234388 (MAPK1)
   04370 VEGF signaling pathway
    119234388 (MAPK1)
   04371 Apelin signaling pathway
    119234388 (MAPK1)
   04668 TNF signaling pathway
    119234388 (MAPK1)
   04066 HIF-1 signaling pathway
    119234388 (MAPK1)
   04068 FoxO signaling pathway
    119234388 (MAPK1)
   04072 Phospholipase D signaling pathway
    119234388 (MAPK1)
   04071 Sphingolipid signaling pathway
    119234388 (MAPK1)
   04024 cAMP signaling pathway
    119234388 (MAPK1)
   04022 cGMP-PKG signaling pathway
    119234388 (MAPK1)
   04151 PI3K-Akt signaling pathway
    119234388 (MAPK1)
   04150 mTOR signaling pathway
    119234388 (MAPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    119234388 (MAPK1)
   04148 Efferocytosis
    119234388 (MAPK1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    119234388 (MAPK1)
   04210 Apoptosis
    119234388 (MAPK1)
   04218 Cellular senescence
    119234388 (MAPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    119234388 (MAPK1)
   04520 Adherens junction
    119234388 (MAPK1)
   04540 Gap junction
    119234388 (MAPK1)
   04550 Signaling pathways regulating pluripotency of stem cells
    119234388 (MAPK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    119234388 (MAPK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    119234388 (MAPK1)
   04613 Neutrophil extracellular trap formation
    119234388 (MAPK1)
   04620 Toll-like receptor signaling pathway
    119234388 (MAPK1)
   04621 NOD-like receptor signaling pathway
    119234388 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    119234388 (MAPK1)
   04650 Natural killer cell mediated cytotoxicity
    119234388 (MAPK1)
   04660 T cell receptor signaling pathway
    119234388 (MAPK1)
   04658 Th1 and Th2 cell differentiation
    119234388 (MAPK1)
   04659 Th17 cell differentiation
    119234388 (MAPK1)
   04657 IL-17 signaling pathway
    119234388 (MAPK1)
   04662 B cell receptor signaling pathway
    119234388 (MAPK1)
   04664 Fc epsilon RI signaling pathway
    119234388 (MAPK1)
   04666 Fc gamma R-mediated phagocytosis
    119234388 (MAPK1)
   04062 Chemokine signaling pathway
    119234388 (MAPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    119234388 (MAPK1)
   04929 GnRH secretion
    119234388 (MAPK1)
   04912 GnRH signaling pathway
    119234388 (MAPK1)
   04915 Estrogen signaling pathway
    119234388 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    119234388 (MAPK1)
   04917 Prolactin signaling pathway
    119234388 (MAPK1)
   04921 Oxytocin signaling pathway
    119234388 (MAPK1)
   04926 Relaxin signaling pathway
    119234388 (MAPK1)
   04935 Growth hormone synthesis, secretion and action
    119234388 (MAPK1)
   04919 Thyroid hormone signaling pathway
    119234388 (MAPK1)
   04928 Parathyroid hormone synthesis, secretion and action
    119234388 (MAPK1)
   04916 Melanogenesis
    119234388 (MAPK1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    119234388 (MAPK1)
   04270 Vascular smooth muscle contraction
    119234388 (MAPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    119234388 (MAPK1)
  09156 Nervous system
   04724 Glutamatergic synapse
    119234388 (MAPK1)
   04725 Cholinergic synapse
    119234388 (MAPK1)
   04726 Serotonergic synapse
    119234388 (MAPK1)
   04720 Long-term potentiation
    119234388 (MAPK1)
   04730 Long-term depression
    119234388 (MAPK1)
   04723 Retrograde endocannabinoid signaling
    119234388 (MAPK1)
   04722 Neurotrophin signaling pathway
    119234388 (MAPK1)
  09158 Development and regeneration
   04360 Axon guidance
    119234388 (MAPK1)
   04380 Osteoclast differentiation
    119234388 (MAPK1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    119234388 (MAPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    119234388 (MAPK1)
   05206 MicroRNAs in cancer
    119234388 (MAPK1)
   05205 Proteoglycans in cancer
    119234388 (MAPK1)
   05207 Chemical carcinogenesis - receptor activation
    119234388 (MAPK1)
   05208 Chemical carcinogenesis - reactive oxygen species
    119234388 (MAPK1)
   05203 Viral carcinogenesis
    119234388 (MAPK1)
   05230 Central carbon metabolism in cancer
    119234388 (MAPK1)
   05231 Choline metabolism in cancer
    119234388 (MAPK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    119234388 (MAPK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    119234388 (MAPK1)
   05212 Pancreatic cancer
    119234388 (MAPK1)
   05225 Hepatocellular carcinoma
    119234388 (MAPK1)
   05226 Gastric cancer
    119234388 (MAPK1)
   05214 Glioma
    119234388 (MAPK1)
   05216 Thyroid cancer
    119234388 (MAPK1)
   05221 Acute myeloid leukemia
    119234388 (MAPK1)
   05220 Chronic myeloid leukemia
    119234388 (MAPK1)
   05218 Melanoma
    119234388 (MAPK1)
   05211 Renal cell carcinoma
    119234388 (MAPK1)
   05219 Bladder cancer
    119234388 (MAPK1)
   05215 Prostate cancer
    119234388 (MAPK1)
   05213 Endometrial cancer
    119234388 (MAPK1)
   05224 Breast cancer
    119234388 (MAPK1)
   05223 Non-small cell lung cancer
    119234388 (MAPK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    119234388 (MAPK1)
   05170 Human immunodeficiency virus 1 infection
    119234388 (MAPK1)
   05161 Hepatitis B
    119234388 (MAPK1)
   05160 Hepatitis C
    119234388 (MAPK1)
   05171 Coronavirus disease - COVID-19
    119234388 (MAPK1)
   05164 Influenza A
    119234388 (MAPK1)
   05163 Human cytomegalovirus infection
    119234388 (MAPK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    119234388 (MAPK1)
   05165 Human papillomavirus infection
    119234388 (MAPK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    119234388 (MAPK1)
   05135 Yersinia infection
    119234388 (MAPK1)
   05133 Pertussis
    119234388 (MAPK1)
   05152 Tuberculosis
    119234388 (MAPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    119234388 (MAPK1)
   05140 Leishmaniasis
    119234388 (MAPK1)
   05142 Chagas disease
    119234388 (MAPK1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    119234388 (MAPK1)
   05020 Prion disease
    119234388 (MAPK1)
   05022 Pathways of neurodegeneration - multiple diseases
    119234388 (MAPK1)
  09165 Substance dependence
   05034 Alcoholism
    119234388 (MAPK1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    119234388 (MAPK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    119234388 (MAPK1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    119234388 (MAPK1)
   04934 Cushing syndrome
    119234388 (MAPK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    119234388 (MAPK1)
   01524 Platinum drug resistance
    119234388 (MAPK1)
   01522 Endocrine resistance
    119234388 (MAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tod01001]
    119234388 (MAPK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tod03036]
    119234388 (MAPK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tod04147]
    119234388 (MAPK1)
Enzymes [BR:tod01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     119234388 (MAPK1)
Protein kinases [BR:tod01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   119234388 (MAPK1)
Chromosome and associated proteins [BR:tod03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     119234388 (MAPK1)
Exosome [BR:tod04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   119234388 (MAPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH STATB_N Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 119234388
NCBI-ProteinID: XP_037353190
LinkDB
Position
Unknown
AA seq 360 aa
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFE
HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQH
LSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDH
TGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHI
LGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK
RIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggcggcagcggcggcggcgggcgcgggcccggagatggtccgcgggcaggtgttcgac
gtggggccgcgctacaccaacctttcgtacatcggcgagggcgcctacggcatggtgtgc
tctgcttatgataatgtcaacaaagttcgggtagctatcaagaaaatcagtccttttgag
caccagacctactgccagagaacgctgagggagataaaaatcttactgcgcttcagacat
gagaatatcattggaattaatgatattattcgagcacccaccatcgagcaaatgaaagat
gtatatatagtacaggacctcatggaaacagatctctacaaactcttgaagacacaacac
ctcagcaatgaccatatctgctattttctttatcagatcctcagagggttaaaatatatc
cattcagctaatgtactgcaccgtgacctcaaaccatccaacttgctgctcaacaccacc
tgtgatctcaagatctgtgactttggattggcgcgtgttgcagatcccgaccatgatcac
acagggttcctgacagagtatgtagctacacgttggtatagggctccggaaattatgttg
aactccaagggctataccaagtccattgatatttggtctgtaggctgcattctggcagag
atgctctccaacaggcccatcttcccaggaaagcattatcttgaccagctgaaccacatt
ctgggtattcttggatccccatcacaggaagacctgaattgtataataaatttaaaagct
agaaactacttgctttctcttccacacaaaaataaggtgccatggaacaggctgttccca
aatgctgactctaaagctctggacttactggacaaaatgttgacattcaaccctcacaag
aggattgaggtagaacaggctctggcccacccatatctggagcagtattatgatccaagt
gatgagcccattgctgaagcaccgttcaaatttgacatggaattggatgacttgcccaag
gaaaagctcaaagaactcatttttgaagagactgctagattccagccaggatacagatct
taa

DBGET integrated database retrieval system