Talpa occidentalis (Iberian mole): 119234413 Help Entry 119234413         CDS       T07495                                  Symbol BCL2L1 Name (RefSeq) bcl-2-like protein 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism tod  Talpa occidentalis (Iberian mole) Pathway tod01521   EGFR tyrosine kinase inhibitor resistance tod01524   Platinum drug resistance tod04014   Ras signaling pathway tod04064   NF-kappa B signaling pathway tod04115   p53 signaling pathway tod04137   Mitophagy - animal tod04140   Autophagy - animal tod04151   PI3K-Akt signaling pathway tod04210   Apoptosis tod04215   Apoptosis - multiple species tod04621   NOD-like receptor signaling pathway tod04630   JAK-STAT signaling pathway tod05012   Parkinson disease tod05014   Amyotrophic lateral sclerosis tod05022   Pathways of neurodegeneration - multiple diseases tod05145   Toxoplasmosis tod05162   Measles tod05166   Human T-cell leukemia virus 1 infection tod05168   Herpes simplex virus 1 infection tod05170   Human immunodeficiency virus 1 infection tod05200   Pathways in cancer tod05202   Transcriptional misregulation in cancer tod05212   Pancreatic cancer tod05220   Chronic myeloid leukemia tod05222   Small cell lung cancer tod05225   Hepatocellular carcinoma tod05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:tod00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     119234413 (BCL2L1)    04630 JAK-STAT signaling pathway     119234413 (BCL2L1)    04064 NF-kappa B signaling pathway     119234413 (BCL2L1)    04151 PI3K-Akt signaling pathway     119234413 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     119234413 (BCL2L1)    04137 Mitophagy - animal     119234413 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     119234413 (BCL2L1)    04215 Apoptosis - multiple species     119234413 (BCL2L1)    04115 p53 signaling pathway     119234413 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     119234413 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     119234413 (BCL2L1)    05202 Transcriptional misregulation in cancer     119234413 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     119234413 (BCL2L1)    05225 Hepatocellular carcinoma     119234413 (BCL2L1)    05220 Chronic myeloid leukemia     119234413 (BCL2L1)    05222 Small cell lung cancer     119234413 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     119234413 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     119234413 (BCL2L1)    05162 Measles     119234413 (BCL2L1)    05168 Herpes simplex virus 1 infection     119234413 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     119234413 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     119234413 (BCL2L1)    05014 Amyotrophic lateral sclerosis     119234413 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     119234413 (BCL2L1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     119234413 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     119234413 (BCL2L1)    01524 Platinum drug resistance     119234413 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:tod01009]     119234413 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tod03036]     119234413 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:tod02000]     119234413 (BCL2L1) Protein phosphatases and associated proteins [BR:tod01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      119234413 (BCL2L1) Chromosome and associated proteins [BR:tod03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     119234413 (BCL2L1) Transporters [BR:tod02000]  Other transporters   Pores ion channels [TC:1]    119234413 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  119234413 NCBI-ProteinID:  XP_037353237 LinkDB All DBs Position Unknown AA seq 233 aa AA seqDB search MSQSNRDLVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLV DSPALNGATGHSSSLDAREVIPLAAVKQALREAGDEFELRYRRAFNDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIASWMATYLNDHLEP WIQENGGWDTFVDLYGNNAAAESRKGQERFNRWLLTGMTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgggacctggtggttgactttctctcctacaagctttcccagaaa ggatacagctggagtcagtttagtgatgtggaagagaacagaactgaggccccagaaggg actgaatcagagatggaaacccccagtgccatcaatggcaacccatcctggcacctggtg gacagccccgcattgaatggagccactggccacagcagcagcttggatgccagggaggtg atccccttggcagcagtgaagcaagcactgagggaggccggcgatgagtttgaactaagg taccggcgggcattcaatgacctgacatcccagctccacatcaccccagggacagcatat cagagttttgagcaggtagtgaatgaactcttccgggatggggtgaactggggtcgcatt gtggcctttttctccttcggtggggcactatgcgtggaaagcgtagacaaggagatgcag gtattggtgagtcggatcgcatcttggatggctacttacctgaatgaccacctagagcct tggatccaggagaacggcggctgggatacttttgtggatctctatgggaacaacgcggcg gccgagagccggaagggccaggaacgcttcaaccgctggttgctgacgggcatgactgtg gccggcgtggttctgctgggctcactcttcagtcggaaatga

DBGET integrated database retrieval system