Talpa occidentalis (Iberian mole): 119235421 Help Entry 119235421         CDS       T07495                                  Symbol JUN Name (RefSeq) transcription factor Jun   KO K04448   transcription factor AP-1 Organism tod  Talpa occidentalis (Iberian mole) Pathway tod01522   Endocrine resistance tod04010   MAPK signaling pathway tod04012   ErbB signaling pathway tod04024   cAMP signaling pathway tod04137   Mitophagy - animal tod04210   Apoptosis tod04310   Wnt signaling pathway tod04380   Osteoclast differentiation tod04510   Focal adhesion tod04530   Tight junction tod04620   Toll-like receptor signaling pathway tod04621   NOD-like receptor signaling pathway tod04625   C-type lectin receptor signaling pathway tod04657   IL-17 signaling pathway tod04658   Th1 and Th2 cell differentiation tod04659   Th17 cell differentiation tod04660   T cell receptor signaling pathway tod04662   B cell receptor signaling pathway tod04668   TNF signaling pathway tod04722   Neurotrophin signaling pathway tod04912   GnRH signaling pathway tod04915   Estrogen signaling pathway tod04921   Oxytocin signaling pathway tod04926   Relaxin signaling pathway tod04932   Non-alcoholic fatty liver disease tod04933   AGE-RAGE signaling pathway in diabetic complications tod05030   Cocaine addiction tod05031   Amphetamine addiction tod05132   Salmonella infection tod05133   Pertussis tod05135   Yersinia infection tod05140   Leishmaniasis tod05142   Chagas disease tod05161   Hepatitis B tod05162   Measles tod05166   Human T-cell leukemia virus 1 infection tod05167   Kaposi sarcoma-associated herpesvirus infection tod05169   Epstein-Barr virus infection tod05170   Human immunodeficiency virus 1 infection tod05171   Coronavirus disease - COVID-19 tod05200   Pathways in cancer tod05203   Viral carcinogenesis tod05207   Chemical carcinogenesis - receptor activation tod05208   Chemical carcinogenesis - reactive oxygen species tod05210   Colorectal cancer tod05211   Renal cell carcinoma tod05224   Breast cancer tod05231   Choline metabolism in cancer tod05235   PD-L1 expression and PD-1 checkpoint pathway in cancer tod05321   Inflammatory bowel disease tod05323   Rheumatoid arthritis tod05417   Lipid and atherosclerosis tod05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:tod00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     119235421 (JUN)    04012 ErbB signaling pathway     119235421 (JUN)    04310 Wnt signaling pathway     119235421 (JUN)    04668 TNF signaling pathway     119235421 (JUN)    04024 cAMP signaling pathway     119235421 (JUN)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     119235421 (JUN)   09143 Cell growth and death    04210 Apoptosis     119235421 (JUN)   09144 Cellular community - eukaryotes    04510 Focal adhesion     119235421 (JUN)    04530 Tight junction     119235421 (JUN)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     119235421 (JUN)    04621 NOD-like receptor signaling pathway     119235421 (JUN)    04625 C-type lectin receptor signaling pathway     119235421 (JUN)    04660 T cell receptor signaling pathway     119235421 (JUN)    04658 Th1 and Th2 cell differentiation     119235421 (JUN)    04659 Th17 cell differentiation     119235421 (JUN)    04657 IL-17 signaling pathway     119235421 (JUN)    04662 B cell receptor signaling pathway     119235421 (JUN)   09152 Endocrine system    04912 GnRH signaling pathway     119235421 (JUN)    04915 Estrogen signaling pathway     119235421 (JUN)    04921 Oxytocin signaling pathway     119235421 (JUN)    04926 Relaxin signaling pathway     119235421 (JUN)   09156 Nervous system    04722 Neurotrophin signaling pathway     119235421 (JUN)   09158 Development and regeneration    04380 Osteoclast differentiation     119235421 (JUN)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     119235421 (JUN)    05207 Chemical carcinogenesis - receptor activation     119235421 (JUN)    05208 Chemical carcinogenesis - reactive oxygen species     119235421 (JUN)    05203 Viral carcinogenesis     119235421 (JUN)    05231 Choline metabolism in cancer     119235421 (JUN)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     119235421 (JUN)   09162 Cancer: specific types    05210 Colorectal cancer     119235421 (JUN)    05211 Renal cell carcinoma     119235421 (JUN)    05224 Breast cancer     119235421 (JUN)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     119235421 (JUN)    05170 Human immunodeficiency virus 1 infection     119235421 (JUN)    05161 Hepatitis B     119235421 (JUN)    05171 Coronavirus disease - COVID-19     119235421 (JUN)    05162 Measles     119235421 (JUN)    05167 Kaposi sarcoma-associated herpesvirus infection     119235421 (JUN)    05169 Epstein-Barr virus infection     119235421 (JUN)   09171 Infectious disease: bacterial    05132 Salmonella infection     119235421 (JUN)    05135 Yersinia infection     119235421 (JUN)    05133 Pertussis     119235421 (JUN)   09174 Infectious disease: parasitic    05140 Leishmaniasis     119235421 (JUN)    05142 Chagas disease     119235421 (JUN)   09163 Immune disease    05323 Rheumatoid arthritis     119235421 (JUN)    05321 Inflammatory bowel disease     119235421 (JUN)   09165 Substance dependence    05030 Cocaine addiction     119235421 (JUN)    05031 Amphetamine addiction     119235421 (JUN)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     119235421 (JUN)    05418 Fluid shear stress and atherosclerosis     119235421 (JUN)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     119235421 (JUN)    04933 AGE-RAGE signaling pathway in diabetic complications     119235421 (JUN)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     119235421 (JUN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:tod03000]     119235421 (JUN) Transcription factors [BR:tod03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Jun     119235421 (JUN) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Jun bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 ZapB PspA_IM30 Fib_alpha DUF3450 TFIIA FlaC_arch ATG16 Motif Other DBs NCBI-GeneID:  119235421 NCBI-ProteinID:  XP_037354669 LinkDB All DBs Position Unknown AA seq 333 aa AA seqDB search MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE LHSQNTLPSVTSAAQPVSGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGA LSSGGGAPSYGATGLAFSAQPQQQQQPPQAHHLPQQIPVQHPRLQALKEEPQTVPEMPGE TPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTA NMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt atgactgcaaagatggaaacgaccttctacgacgatgccctcaacgcctcgttcctccag tccgagagcggcgcgtacggctacagtaaccccaagatcctgaagcagagcatgaccctg aacctggcggacccggtgggcagcctgaagccgcacctccgggccaagaactccgacctc cttacctcgcccgacgtggggctgctcaagttggcgtcgccggagctggagcgcctgatc atccagtccagcaacgggcacatcaccaccacgccgacccccactcagttcctgtgcccc aagaacgtgacggacgagcaggagggcttcgcggagggcttcgtgcgcgccctggccgag ctgcacagccagaacacgctccccagcgtcacgtccgcggcgcagccggtcagcggggcg ggcatggtggctcccgcggtggcttcggtggcgggcggcagcgggagcggcggcttcagc gccagcctgcacagcgagccgccggtctacgccaacctcagcaacttcaaccccggcgct ctgagcagcggtggcggggcgccctcctacggcgccaccggcctggccttctcagctcag ccccagcagcagcagcagccgccgcaggctcaccacctgccgcagcagatcccggtgcag cacccgcggctgcaggccctgaaggaggagccgcagacggtgcccgagatgcctggggag acgccgcccctgtcccccatcgacatggagtcccaagagcggatcaaggccgagaggaag cgcatgaggaaccgcatcgccgcctccaagtgccggaaaagaaagctggagaggatcgcc cggctggaggagaaagtgaaaaccttgaaagctcagaactcggagctggcgtccacggct aacatgctcagggaacaggtggcacagcttaaacagaaagtcatgaaccacgttaacagt gggtgccaactcatgctaacgcagcagttgcaaacgttttga

DBGET integrated database retrieval system