Talpa occidentalis (Iberian mole): 119235620 Help Entry 119235620         CDS       T07495                                  Name (RefSeq) cytochrome c-like   KO K08738   cytochrome c Organism tod  Talpa occidentalis (Iberian mole) Pathway tod00190   Oxidative phosphorylation tod01100   Metabolic pathways tod01524   Platinum drug resistance tod04115   p53 signaling pathway tod04210   Apoptosis tod04215   Apoptosis - multiple species tod04932   Non-alcoholic fatty liver disease tod05010   Alzheimer disease tod05012   Parkinson disease tod05014   Amyotrophic lateral sclerosis tod05016   Huntington disease tod05017   Spinocerebellar ataxia tod05020   Prion disease tod05022   Pathways of neurodegeneration - multiple diseases tod05132   Salmonella infection tod05134   Legionellosis tod05145   Toxoplasmosis tod05152   Tuberculosis tod05160   Hepatitis C tod05161   Hepatitis B tod05162   Measles tod05163   Human cytomegalovirus infection tod05164   Influenza A tod05167   Kaposi sarcoma-associated herpesvirus infection tod05168   Herpes simplex virus 1 infection tod05169   Epstein-Barr virus infection tod05170   Human immunodeficiency virus 1 infection tod05200   Pathways in cancer tod05210   Colorectal cancer tod05222   Small cell lung cancer tod05416   Viral myocarditis tod05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:tod00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     119235620  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     119235620    04215 Apoptosis - multiple species     119235620    04115 p53 signaling pathway     119235620  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     119235620   09162 Cancer: specific types    05210 Colorectal cancer     119235620    05222 Small cell lung cancer     119235620   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     119235620    05161 Hepatitis B     119235620    05160 Hepatitis C     119235620    05164 Influenza A     119235620    05162 Measles     119235620    05168 Herpes simplex virus 1 infection     119235620    05163 Human cytomegalovirus infection     119235620    05167 Kaposi sarcoma-associated herpesvirus infection     119235620    05169 Epstein-Barr virus infection     119235620   09171 Infectious disease: bacterial    05132 Salmonella infection     119235620    05134 Legionellosis     119235620    05152 Tuberculosis     119235620   09174 Infectious disease: parasitic    05145 Toxoplasmosis     119235620   09164 Neurodegenerative disease    05010 Alzheimer disease     119235620    05012 Parkinson disease     119235620    05014 Amyotrophic lateral sclerosis     119235620    05016 Huntington disease     119235620    05017 Spinocerebellar ataxia     119235620    05020 Prion disease     119235620    05022 Pathways of neurodegeneration - multiple diseases     119235620   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     119235620    05416 Viral myocarditis     119235620   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     119235620   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     119235620 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 CCP_MauG Motif Other DBs NCBI-GeneID:  119235620 NCBI-ProteinID:  XP_037354988 LinkDB All DBs Position Unknown AA seq 88 aa AA seqDB search MSDIEKGKKIFVQKCAQCHPVEKGGKHKTGPNLYGLFGRKTGQAPGFSYTDANKNKGITW KEDTLMEYLENPKKYIPGTKMIFTGIKK NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgagtgacattgagaagggcaagaagatttttgttcaaaagtgtgcccagtgccatcct gtggaaaagggaggcaagcacaaaactgggccaaatctctatggtctctttgggcgaaag acaggtcaggcccctggattttcttacacagatgccaacaagaacaaaggcatcacctgg aaagaggacacactgatggagtatttggagaatcccaagaagtacatccctggaacaaaa atgatcttcactggcattaagaagtag

DBGET integrated database retrieval system