Talpa occidentalis (Iberian mole): 119236111 Help Entry 119236111         CDS       T07495                                  Symbol S100A10 Name (RefSeq) protein S100-A10   KO K17274   protein S100-A10 Organism tod  Talpa occidentalis (Iberian mole) Pathway tod04382   Cornified envelope formation tod05132   Salmonella infection Brite KEGG Orthology (KO) [BR:tod00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     119236111 (S100A10)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     119236111 (S100A10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tod04147]     119236111 (S100A10) Exosome [BR:tod04147]  Exosomal proteins   Exosomal proteins of microglial cells    119236111 (S100A10) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EFhand_Ca_insen EF-hand_8 EF-hand_6 TMP_3 Motif Other DBs NCBI-GeneID:  119236111 NCBI-ProteinID:  XP_037355641 LinkDB All DBs Position Unknown AA seq 97 aa AA seqDB search MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLD QCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccatctcaaatggaacatgccatggaaacaatgatgttcacctttcacaaatttgct ggggataaaggctacttaacgaaggaggacctgcgagtactcatggaaaaggagttccct ggatttttggaaaatcaaaaagaccccctggctgtggacaaaataatgaaggacctggac cagtgccgagatggcaaagtgggcttccagagcttcttctccctgattgcggggctcacc attgcctgcaacgactattttgtagtacacatgaagcagaagggaaagaagtag

DBGET integrated database retrieval system