Talpa occidentalis (Iberian mole): 119236359 Help Entry 119236359         CDS       T07495                                  Symbol GSTM3 Name (RefSeq) glutathione S-transferase Mu 3   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism tod  Talpa occidentalis (Iberian mole) Pathway tod00480   Glutathione metabolism tod00980   Metabolism of xenobiotics by cytochrome P450 tod00982   Drug metabolism - cytochrome P450 tod00983   Drug metabolism - other enzymes tod01100   Metabolic pathways tod01524   Platinum drug resistance tod05200   Pathways in cancer tod05204   Chemical carcinogenesis - DNA adducts tod05207   Chemical carcinogenesis - receptor activation tod05208   Chemical carcinogenesis - reactive oxygen species tod05225   Hepatocellular carcinoma tod05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:tod00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     119236359 (GSTM3)   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     119236359 (GSTM3)    00982 Drug metabolism - cytochrome P450     119236359 (GSTM3)    00983 Drug metabolism - other enzymes     119236359 (GSTM3)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     119236359 (GSTM3)    05204 Chemical carcinogenesis - DNA adducts     119236359 (GSTM3)    05207 Chemical carcinogenesis - receptor activation     119236359 (GSTM3)    05208 Chemical carcinogenesis - reactive oxygen species     119236359 (GSTM3)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     119236359 (GSTM3)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     119236359 (GSTM3)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     119236359 (GSTM3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:tod02000]     119236359 (GSTM3) Enzymes [BR:tod01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      119236359 (GSTM3) Transporters [BR:tod02000]  Other transporters   Pores ion channels [TC:1]    119236359 (GSTM3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GST_C GST_N GST_C_3 GST_N_3 GST_N_2 GST_C_6 Motif Other DBs NCBI-GeneID:  119236359 NCBI-ProteinID:  XP_037356075 LinkDB All DBs Position Unknown AA seq 225 aa AA seqDB search MSAKSTMILGYWDIRGLAHAIRMLLEFTDTAYEEKRYTCGEAPDYDRSQWLDVKFKLDLD FPNLPYLMDGKNKITQSNAILRYIARKHNMCGDTEEEKIRVDIMENQIMDFRMQLVRLCY HADHEKLKPQYLEQLPGQLKQFSLFLGKFSWFAGEKLTFVDFLTYDVLDQNRMFEPKCLE EFPNLKAFMCRFEALEKIAAFLQSDRSFKLPINNKMAQWGNKRPC NT seq 678 nt NT seq  +upstreamnt  +downstreamnt atgtcggccaagtcgaccatgatcctgggctactgggatatccgcgggctggcgcacgcc atccgcatgctcctggagttcaccgacaccgcctacgaggagaaacggtacacgtgcggg gaagctcctgactatgacagaagccaatggctggatgtgaaattcaagctagatctggac ttccccaacctgccctatctcatggacggtaagaacaagatcacccagagcaatgccatc ttgcgctacattgcccgcaagcataatatgtgcggtgacactgaagaagagaagattcgc gtggacatcatggagaaccaaatcatggatttccgcatgcaacttgtacggctctgctat cacgccgaccacgaaaaactgaagcctcagtacttggaacaactacctggacaactgaaa caattctccctgttcctgggaaaattctcctggtttgcaggggaaaagctcacctttgtg gatttccttacctacgatgtcttggatcagaaccggatgtttgagcccaagtgcctggaa gaatttccaaatctgaaggctttcatgtgccgttttgaggctttggagaaaatagctgca ttcctgcaatccgaccgctccttcaagttgcctatcaacaacaagatggcccagtggggt aacaagagaccctgctga

DBGET integrated database retrieval system