Talpa occidentalis (Iberian mole): 119236715 Help Entry 119236715         CDS       T07495                                  Name (RefSeq) histone H3   KO K11253   histone H3 Organism tod  Talpa occidentalis (Iberian mole) Pathway tod04613   Neutrophil extracellular trap formation tod05034   Alcoholism tod05202   Transcriptional misregulation in cancer tod05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:tod00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     119236715  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     119236715   09163 Immune disease    05322 Systemic lupus erythematosus     119236715   09165 Substance dependence    05034 Alcoholism     119236715  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tod03036]     119236715   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tod04147]     119236715 Chromosome and associated proteins [BR:tod03036]  Eukaryotic type   Nucleosome assembly factors    Histones     119236715 Exosome [BR:tod04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    119236715 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  119236715 NCBI-ProteinID:  XP_037356578 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggcccgcacgaagcagacggcccgtaagtccaccggcggcaaggccccgcgcaagcag ctggccaccaaggcggcccgcaagagcgcgccggccacgggcggcgtcaagaagccgcac cgctaccggcccggcaccgtggcgctgcgcgagatccgccgctaccagaagtccaccgag ctgctcatccgcaagctgcccttccagcgcctggtgcgcgagatcgcgcaggacttcaag accgacctgcgcttccagagctcggccgtcatggcgctgcaggaggcgagcgaggcctac ctggtggggctgttcgaggacaccaacctgtgcgccatccacgccaagcgcgtcaccatc atgcccaaggacatccagctggcgcgccgcatccgcggggagcgcgcctaa

DBGET integrated database retrieval system