Talpa occidentalis (Iberian mole): 119237290 Help Entry 119237290         CDS       T07495                                  Symbol CENPS Name (RefSeq) centromere protein S   KO K11511   centromere protein S Organism tod  Talpa occidentalis (Iberian mole) Pathway tod03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:tod00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     119237290 (CENPS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tod03036]     119237290 (CENPS)    03400 DNA repair and recombination proteins [BR:tod03400]     119237290 (CENPS) Chromosome and associated proteins [BR:tod03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      119237290 (CENPS) DNA repair and recombination proteins [BR:tod03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      119237290 (CENPS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-S CENP-T_C Histone TFIID-31kDa COMMD1_N Bromo_TP DUF4087 Motif Other DBs NCBI-GeneID:  119237290 NCBI-ProteinID:  XP_037357376 LinkDB All DBs Position Unknown AA seq 137 aa AA seqDB search MAEADEAEEQQRFSYQQRLKAAVHYTVGCLCDEVAADKEIEFSKQTIAAISEVTFRQCEN FARDLEMFARHAKRSTINTEDVKLLARRSHSLLKYITEKNEELTQLNVERKAKKKKLENE NRSSVELAEAAGVESED NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atggcggaggccgacgaggccgaggagcagcagcgattctcttaccaacagcggctgaag gcggccgtccactacaccgtcggctgcctttgcgatgaagtcgcggcagacaaagagata gagttcagcaaacaaaccatcgcggcgatttcggaggtgacttttcgacaatgcgaaaat tttgccagagaccttgaaatgtttgccagacacgcgaaaagaagcacaattaacacggaa gatgtgaagctcttagccaggaggagtcattcgctgctaaaatacatcacagagaaaaat gaagagctcactcagttgaatgtagaaagaaaagcaaagaagaaaaagttagagaatgaa aacagaagctcagtagagctcgcagaggctgcaggagtggaaagtgaggactaa

DBGET integrated database retrieval system