Talpa occidentalis (Iberian mole): 119238109 Help Entry 119238109         CDS       T07495                                  Name (RefSeq) thioredoxin-like   KO K03671   thioredoxin Organism tod  Talpa occidentalis (Iberian mole) Pathway tod04621   NOD-like receptor signaling pathway tod05012   Parkinson disease tod05132   Salmonella infection tod05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:tod00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     119238109  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     119238109   09164 Neurodegenerative disease    05012 Parkinson disease     119238109   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     119238109  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:tod03110]     119238109 Chaperones and folding catalysts [BR:tod03110]  Protein folding catalysts   Protein disulfide isomerase    119238109 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin OST3_OST6 DIM1 Thioredoxin_8 Thioredoxin_2 Glutaredoxin Thioredoxin_7 Motif Other DBs NCBI-GeneID:  119238109 NCBI-ProteinID:  XP_037357735 LinkDB All DBs Position Unknown AA seq 119 aa AA seqDB search MDDSARTSQTLAAKVVKQIDSKFAFQDALNGAGDKLVVVDFSATRCGTCKMIKPFFHALS EKYTNVVFLEVDVDDCQDVALDCEVKCMPTFQFFKKGQKVGEFSGANKDKLEATINELI NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggatgattcagcaagaacaagtcagactcttgcagccaaagtggtgaagcagattgac agcaagtttgcttttcaggacgccttgaatggtgcaggagataaactggtagtcgttgac ttctcggccacaaggtgtgggacttgcaaaatgatcaagcctttctttcacgccctctct gaaaagtacaccaatgtggtgttccttgaagttgatgtggatgactgtcaggatgtcgct ttagattgtgaagtcaaatgtatgccaactttccagttttttaaaaagggacaaaaggtg ggtgaattttctggagcaaataaggacaaacttgaagccaccattaatgaattaatctaa

DBGET integrated database retrieval system