Talpa occidentalis (Iberian mole): 119239019 Help Entry 119239019         CDS       T07495                                  Symbol NFKBIA Name (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism tod  Talpa occidentalis (Iberian mole) Pathway tod04024   cAMP signaling pathway tod04062   Chemokine signaling pathway tod04064   NF-kappa B signaling pathway tod04210   Apoptosis tod04380   Osteoclast differentiation tod04620   Toll-like receptor signaling pathway tod04621   NOD-like receptor signaling pathway tod04622   RIG-I-like receptor signaling pathway tod04623   Cytosolic DNA-sensing pathway tod04625   C-type lectin receptor signaling pathway tod04657   IL-17 signaling pathway tod04658   Th1 and Th2 cell differentiation tod04659   Th17 cell differentiation tod04660   T cell receptor signaling pathway tod04662   B cell receptor signaling pathway tod04668   TNF signaling pathway tod04722   Neurotrophin signaling pathway tod04920   Adipocytokine signaling pathway tod04926   Relaxin signaling pathway tod04931   Insulin resistance tod04936   Alcoholic liver disease tod05132   Salmonella infection tod05134   Legionellosis tod05135   Yersinia infection tod05140   Leishmaniasis tod05142   Chagas disease tod05145   Toxoplasmosis tod05160   Hepatitis C tod05161   Hepatitis B tod05162   Measles tod05163   Human cytomegalovirus infection tod05164   Influenza A tod05166   Human T-cell leukemia virus 1 infection tod05167   Kaposi sarcoma-associated herpesvirus infection tod05168   Herpes simplex virus 1 infection tod05169   Epstein-Barr virus infection tod05170   Human immunodeficiency virus 1 infection tod05171   Coronavirus disease - COVID-19 tod05200   Pathways in cancer tod05203   Viral carcinogenesis tod05208   Chemical carcinogenesis - reactive oxygen species tod05215   Prostate cancer tod05220   Chronic myeloid leukemia tod05222   Small cell lung cancer tod05235   PD-L1 expression and PD-1 checkpoint pathway in cancer tod05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:tod00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     119239019 (NFKBIA)    04668 TNF signaling pathway     119239019 (NFKBIA)    04024 cAMP signaling pathway     119239019 (NFKBIA)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     119239019 (NFKBIA)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     119239019 (NFKBIA)    04621 NOD-like receptor signaling pathway     119239019 (NFKBIA)    04622 RIG-I-like receptor signaling pathway     119239019 (NFKBIA)    04623 Cytosolic DNA-sensing pathway     119239019 (NFKBIA)    04625 C-type lectin receptor signaling pathway     119239019 (NFKBIA)    04660 T cell receptor signaling pathway     119239019 (NFKBIA)    04658 Th1 and Th2 cell differentiation     119239019 (NFKBIA)    04659 Th17 cell differentiation     119239019 (NFKBIA)    04657 IL-17 signaling pathway     119239019 (NFKBIA)    04662 B cell receptor signaling pathway     119239019 (NFKBIA)    04062 Chemokine signaling pathway     119239019 (NFKBIA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     119239019 (NFKBIA)    04926 Relaxin signaling pathway     119239019 (NFKBIA)   09156 Nervous system    04722 Neurotrophin signaling pathway     119239019 (NFKBIA)   09158 Development and regeneration    04380 Osteoclast differentiation     119239019 (NFKBIA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     119239019 (NFKBIA)    05208 Chemical carcinogenesis - reactive oxygen species     119239019 (NFKBIA)    05203 Viral carcinogenesis     119239019 (NFKBIA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     119239019 (NFKBIA)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     119239019 (NFKBIA)    05215 Prostate cancer     119239019 (NFKBIA)    05222 Small cell lung cancer     119239019 (NFKBIA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     119239019 (NFKBIA)    05170 Human immunodeficiency virus 1 infection     119239019 (NFKBIA)    05161 Hepatitis B     119239019 (NFKBIA)    05160 Hepatitis C     119239019 (NFKBIA)    05171 Coronavirus disease - COVID-19     119239019 (NFKBIA)    05164 Influenza A     119239019 (NFKBIA)    05162 Measles     119239019 (NFKBIA)    05168 Herpes simplex virus 1 infection     119239019 (NFKBIA)    05163 Human cytomegalovirus infection     119239019 (NFKBIA)    05167 Kaposi sarcoma-associated herpesvirus infection     119239019 (NFKBIA)    05169 Epstein-Barr virus infection     119239019 (NFKBIA)   09171 Infectious disease: bacterial    05132 Salmonella infection     119239019 (NFKBIA)    05135 Yersinia infection     119239019 (NFKBIA)    05134 Legionellosis     119239019 (NFKBIA)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     119239019 (NFKBIA)    05140 Leishmaniasis     119239019 (NFKBIA)    05142 Chagas disease     119239019 (NFKBIA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     119239019 (NFKBIA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     119239019 (NFKBIA)    04931 Insulin resistance     119239019 (NFKBIA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:tod03000]     119239019 (NFKBIA)    04131 Membrane trafficking [BR:tod04131]     119239019 (NFKBIA) Transcription factors [BR:tod03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     119239019 (NFKBIA) Membrane trafficking [BR:tod04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     119239019 (NFKBIA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ank_2 Ank Ank_3 Ank_5 Ank_4 ANK_LRRK2 Motif Other DBs NCBI-GeneID:  119239019 NCBI-ProteinID:  XP_037359111 LinkDB All DBs Position Unknown AA seq 314 aa AA seqDB search MFQPAELAQDWAMEAPRDALKKERVLDDRHDSGLDSMKDEEYEQMVKELKEIRLEPQEAP RGAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVVRQVKGDLAFINFQNNLQQTPLHLAVI TNQPEIAQALLDAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQACSAQHLHSILKASN YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG ADVNRVTYQGYSPYQLTWGRPSTRIQQQLCQLTLENLQRLPESEDEDSYDTESEFTEDEL PYDDCVLGGQRLTL NT seq 945 nt NT seq  +upstreamnt  +downstreamnt atgttccagcccgccgagctcgcccaggactgggccatggaggcgccccgggacgcgctg aagaaggagcgggtgctggacgaccgccacgacagcggcctggactccatgaaggacgag gaatacgagcagatggtgaaggagctgaaggagatccgcctggagccgcaggaggcgccg cggggcgccgagccctggaaacagcagctcacggaggacggagactcgttcctgcacttg gccatcatccacgaagagaaggcgctgaccatggaagtggtccgtcaagtaaagggagac ctggcttttatcaacttccagaataacctgcagcagactccactccacttggctgtaatc accaaccagccagaaattgctcaggcacttctggatgctggctgtgatcctgagctccga gactttcgaggaaatacccctctacaccttgcctgtgagcagggctgcctggccagtgta ggagtcctgacgcaggcctgtagcgcccagcacctccactctatcctgaaggccagcaac tacaacggccacacgtgtctgcacttagcctctatccatggctacctgggcattgtggag cttttggtgtccttgggtgctgatgtcaatgctcaggagccctgtaatggccggaccgcc ctccatctcgcagtggacttgcagaatcctgacctggtgtccctcctgttgaagtgtggg gctgatgtcaacagagtcacctaccagggctactccccttaccagctcacctggggccgc ccaagcactcggatacagcagcagctgtgtcagctgaccctagaaaaccttcagcggctg ccagagagtgaggatgaggacagctatgacacggagtcagagttcacagaggacgagctt ccctatgatgactgtgtgcttggaggccagcgtctgacgttatga

DBGET integrated database retrieval system