Talpa occidentalis (Iberian mole): 119239794 Help Entry 119239794         CDS       T07495                                  Name (RefSeq) C-C motif chemokine 19-like   KO K05512   C-C motif chemokine 19 Organism tod  Talpa occidentalis (Iberian mole) Pathway tod04060   Cytokine-cytokine receptor interaction tod04061   Viral protein interaction with cytokine and cytokine receptor tod04062   Chemokine signaling pathway tod04064   NF-kappa B signaling pathway Brite KEGG Orthology (KO) [BR:tod00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     119239794   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     119239794    04061 Viral protein interaction with cytokine and cytokine receptor     119239794  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     119239794  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tod04052]     119239794 Cytokines and neuropeptides [BR:tod04052]  Cytokines   Chemokines    119239794 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  119239794 NCBI-ProteinID:  XP_037360085 LinkDB All DBs Position Unknown AA seq 100 aa AA seqDB search MAPHTAALLALSLLALGPSPALGGANDAEDCCLSVTQRPIPGYIVRAFRHLLIKDGCRVP AVVFTTLRGRQLCAPPDQPWVNRIIRRLQKNSAKNKHHSS NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atggcgccccatacagccgcactgctggcccttagtctgctggctcttgggccctcccct gctctgggtggggccaacgatgcggaagactgttgcctgtctgtgacgcagcgccccatc cctgggtacattgtgcgtgccttccgccacctgctcatcaaggatggctgcagagtgcct gctgtggtgttcaccacactgagaggtcgtcagctctgtgcacccccagaccagccctgg gtgaaccgcatcatccggagactgcagaagaactctgccaagaacaagcaccacagcagt taa

DBGET integrated database retrieval system