Talpa occidentalis (Iberian mole): 119240147 Help Entry 119240147         CDS       T07495                                  Symbol CCL24 Name (RefSeq) C-C motif chemokine 24   KO K21097   C-C motif chemokine 24 Organism tod  Talpa occidentalis (Iberian mole) Pathway tod04060   Cytokine-cytokine receptor interaction tod04061   Viral protein interaction with cytokine and cytokine receptor tod04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:tod00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     119240147 (CCL24)    04061 Viral protein interaction with cytokine and cytokine receptor     119240147 (CCL24)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     119240147 (CCL24)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tod04052]     119240147 (CCL24) Cytokines and neuropeptides [BR:tod04052]  Cytokines   Chemokines    119240147 (CCL24) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  119240147 NCBI-ProteinID:  XP_037360405 LinkDB All DBs Position Unknown AA seq 119 aa AA seqDB search MAGTTTLVSVLLLLALCAHCLAPADSVVIPSTCCMNFISKRIPESRVVSYQFSSKSVCPK AGVIFTTKKGKKFCGNPEDHWVQRYMKNLDAKRRKTSAGTAPMAATVSAPRRPCNSPSI NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggcaggtaccacaacccttgtctccgtcctcctgctcctggccctgtgtgcccactgt cttgcccctgcagactccgtggtcatcccctctacctgctgcatgaacttcatttccaag agaattcctgagagccgagtagtcagctaccagttctccagcaagagtgtctgccccaag gcgggggtgatcttcaccaccaagaagggcaagaagttctgtggcaaccctgaggaccat tgggtccagaggtacatgaagaacctggatgccaagaggagaaagacctctgctggcact gcgccgatggctgccacagtcagtgctccgagacgcccttgcaacagcccctccatctaa

DBGET integrated database retrieval system