KEGG   Talpa occidentalis (Iberian mole): 119240169
Entry
119240169         CDS       T07495                                 
Symbol
ITGAX
Name
(RefSeq) integrin alpha-X
  KO
K06462  integrin alpha X
Organism
tod  Talpa occidentalis (Iberian mole)
Pathway
tod04610  Complement and coagulation cascades
tod04810  Regulation of actin cytoskeleton
tod05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:tod00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    119240169 (ITGAX)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    119240169 (ITGAX)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    119240169 (ITGAX)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:tod04515]
    119240169 (ITGAX)
   04090 CD molecules [BR:tod04090]
    119240169 (ITGAX)
Cell adhesion molecules [BR:tod04515]
 Integrins
  Integrin alpha subunits
   119240169 (ITGAX)
CD molecules [BR:tod04090]
 Proteins
  119240169 (ITGAX)
SSDB
Motif
Pfam: VWA Integrin_alpha2 FG-GAP VWA_2 FG-GAP_3 Integrin_alpha VWA_CoxE
Other DBs
NCBI-GeneID: 119240169
NCBI-ProteinID: XP_037360432
LinkDB
Position
Unknown
AA seq 1155 aa
MASTRTSLLLLMGLASSLCFNLDTDQPTIFSKDSAGFGHSVVQYANSRVVVGAPKEIKAA
NQTGGLYQCDYSSGTCNPVALQVPPEAVNMSLGLSLAAATTPPQLLACGPTVHHACSENM
HLTGFCFQFSYPSWQAQRVPSALQECPKREQDIVFLIDGSGSIEPRDFQKMKNFVTTMLR
QFPRPKTQFSLMQFSNQFEEHFTFRKFMASPDPLRLMDSVRQLGGTTHTASAIRRVTNRL
FSASVGARKDASKILIVITDGEKFKDPLDYPQVIPRAEELGIIRYAVGVGEAFQNRRSRR
ELEAIASKPSSEHIFQVDNFDALRDIQNQLQEKIFAIEGTQTTSSSSFELEMSQEGFSAV
FMSDGPVLGAVGSFSWSGGAFLYSKGMSPTFINMSQENVDMRDSYLGYSTELVLWKGVQS
LLLGAPRHQHTGKVVLFTQASGRWRPEANVAGTQIGSYFGASLCSVDVDADGSTDLVLVG
APHYYEQTRGGQVSVCPIPPGRTSWQCVAVLRGEQGHPWARFGAALTVLGDVNGDQLTDV
AIGAPGEQENRGAVYLFHGTSEQGISTSHSQRIAGSQFPLRLQYFGQSLSGGQDLTMDGL
VDLAVGAQGHALLLRTRPVLRMQVRMHFTPSEVSRAVFECQEPAARDRELSGATICLRIY
KISKHRWGDLQSSVTLVLTLDPGRLSPRAVFEQTKTRNLTLVRSLGLSEHCEAVKLLLPT
CVEDAVSPIILRLNFSLVGKPIPSSGNLRPMLAAGEQRYFMASLPFEKNCGADHVCQDDL
GISFDFPGLDNLLVGSNLDLNMSVRVWNDGEDSYGTTATFTYPAGLSYRRVTWDQVQLQS
RSLRLTCDSTPAGSQDAWLTRCSLNHIIFREGAQITFTVTFDVSPKATLGDHLLLTANVS
SENNSPQTSKTTFQKALPVKYAVSTVINSHEHSTKYLNFSASEEEKSSIVQHRYEVKNLG
HRDLPISVNFWAPVELNRVAVWTGMEVVHAQNPSIQCSSERAAPAVADFRSHMQKNPVLD
CSVADCLRFRCDVPSFGVQEELDFILKGNLSFGWVSQTQQKKFQLVSRAEILFNGSTYSQ
FPGQEAFLRAQVEMVLEEYVIYNPIPLVVGSSVGGLLLLAVITAVLYKVGFFKRQYKDMM
EEANGQTLPETEQAQ
NT seq 3468 nt   +upstreamnt  +downstreamnt
atggccagtaccaggacatccctcctcctgttgatgggcctggcttcttctctctgcttc
aatttggacacggaccagccaacaatcttctccaaggacagtgccgggtttggacacagc
gtggtccaatatgccaactcaagggtagtggtcggagcccccaaggagataaaggctgcc
aaccaaacagggggcctctaccagtgtgactacagctcgggcacctgcaaccctgtcgcc
ctgcaggtgcccccagaggctgtgaacatgtccctgggcctgtctctggcggctgccacc
acaccccctcagttgctggcctgcggccccacggtgcaccatgcctgcagcgagaacatg
cacttgacaggtttctgcttccagttcagctatccctcctggcaagcccagagggttcct
tctgccctgcaggagtgcccgaagcgggagcaggacatcgtgttcctgatcgacggctca
ggcagcatcgagcccagagactttcaaaagatgaagaactttgtgacgactatgctgaga
cagttccccagacctaagacccagttctctcttatgcagttctccaaccagttcgaggag
cacttcaccttcaggaaattcatggccagcccagacccgctacgcctgatggattcagtc
agacagctaggcgggaccactcataccgcctcggccatccggagagtcacgaacaggctg
ttcagtgcttcagtgggggcccggaaggatgcctccaagatcctcatagtcatcactgac
ggggagaaatttaaagatcccctggattaccctcaggtgatccccagagccgaggagctg
ggcatcatccgctacgccgttggggtgggcgaggcttttcagaacagaaggtcccgcaga
gaactagaagccattgcatcgaagccctccagtgaacacatatttcaagtggataatttt
gatgctttgagagacattcaaaaccagctgcaagagaagatctttgccattgagggaacg
cagaccacgagcagtagctccttcgaattggagatgtcccaggagggcttcagcgccgtg
ttcatgtctgatggacccgttctgggggccgtggggagcttcagctggtctggaggtgcc
ttcctctactccaagggcatgagtcccaccttcatcaacatgtctcaggagaacgtggac
atgagggactcttacctgggttactccactgagctggtcctttggaagggggtacagagc
ctgctcctgggggccccccgccatcagcacaccgggaaggtcgtcctcttcacccaagcg
tcagggcgatggaggccagaggccaacgtcgcagggacacagatcggctcctacttcggg
gcctccctgtgctctgtggacgtggatgcagatggaagcacagacctggtcctcgtcggg
gccccccattactatgagcagacgcggggaggccaggtgtccgtgtgccccatacccccg
gggaggaccagctggcagtgtgtggctgtcctccgtggggagcagggccacccctgggcg
cgctttggggcagccctgacggtgctgggggatgtgaatggggaccagctgacggatgtg
gccatcggggctccgggagagcaggagaaccggggcgctgtctacctgtttcatggaacc
tcagaacagggcatcagcacctcccacagccagcggatcgcaggctcccagttccctctc
aggctccagtactttgggcagtcgctgagcgggggccaggacctcaccatggacgggctg
gtggacctggccgtgggggcccaggggcacgcgctgctgctcaggaccaggcctgtgctc
aggatgcaggtgcgcatgcatttcacgccttcagaggtctccagggctgtgttcgaatgt
caagagccggcagcccgcgaccgggaactaagtggcgccaccatctgcctgcgaatttat
aaaatctccaagcatcggtggggtgacctccagagttctgtgacccttgtcctgaccctc
gaccccggccgcctgagtccccgtgcagtctttgaacagacaaagacccggaatctgacc
ctcgtccggagcctgggactgagcgagcattgtgaggctgtgaagttgctgcttccgacc
tgtgtggaagacgcagtgagccccatcatcttgcgtctcaacttttccctggtgggcaag
cccattccttcctccgggaacctccggccaatgctcgctgcgggcgagcagagatacttc
atggcctccctcccctttgagaagaactgtggggctgaccatgtgtgccaggatgacctt
ggcatctcctttgacttcccaggcttggacaacctattggtgggaagcaacctggaccta
aacatgagtgtaagagtgtggaatgatggcgaggactcatatggaaccacagccaccttc
acctacccagcagggctgtcttatcggcgcgtgacatgggaccaggtccagctgcagtcg
cgctccctgcgcctgacatgtgacagcaccccagctgggagccaggacgcctggctcacc
cgctgcagcctcaaccacatcatcttccgtgagggcgcccagattaccttcacagtcacc
tttgacgtctcccctaaagccacgctgggagaccaccttctgctgaccgcaaatgtgagc
agtgaaaataacagcccccagaccagcaagaccaccttccagaaggcgcttccggtgaag
tatgctgtctccactgtcatcaacagccatgaacactccaccaagtatctcaacttctcg
gcctcagaggaggagaaaagcagcatagtccagcacagatacgaggtgaaaaatctggga
cacagggacctacccatcagcgtgaacttctgggcgcctgtggagctgaaccgcgtggcc
gtgtggactggcatggaagtcgtgcacgcccagaatccgtccattcagtgctcttcggag
agagcagcgcccgcggtggctgacttccggagccacatgcagaagaatcccgtgctggac
tgctccgtcgctgactgcctgaggttccgctgtgatgtcccctcctttggcgtccaggag
gagcttgacttcatcctgaagggcaacctcagctttggctgggtcagccagactcagcag
aagaagtttcagcttgtgagtagggctgaaatcctgttcaacgggtccacgtattcccag
ttcccaggacaggaggcatttctgagagcccaggtggagatggtgctggaagagtatgtg
atctacaaccccatcccccttgtcgtgggcagctctgtgggaggactgctgctgctggct
gtcatcacagccgtgctctacaaggttggcttcttcaaacgtcagtacaaggatatgatg
gaggaagcaaatggacaaactctcccagaaactgaacaagcccaataa

DBGET integrated database retrieval system