Talpa occidentalis (Iberian mole): 119240748 Help Entry 119240748         CDS       T07495                                  Name (RefSeq) histone H2AX   KO K11251   histone H2A Organism tod  Talpa occidentalis (Iberian mole) Pathway tod03082   ATP-dependent chromatin remodeling tod04217   Necroptosis tod04613   Neutrophil extracellular trap formation tod05034   Alcoholism tod05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:tod00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     119240748  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     119240748  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     119240748  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     119240748   09165 Substance dependence    05034 Alcoholism     119240748  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tod03036]     119240748   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tod04147]     119240748 Chromosome and associated proteins [BR:tod03036]  Eukaryotic type   Nucleosome assembly factors    Histones     119240748 Exosome [BR:tod04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    119240748 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  119240748 NCBI-ProteinID:  XP_037361324 LinkDB All DBs Position Unknown AA seq 143 aa AA seqDB search MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TSATVGPKAPAGGKKATQASQEY NT seq 432 nt NT seq  +upstreamnt  +downstreamnt atgtcgggccgcggcaagacgggcggcaaggcccgcgccaaggccaagtcgcgctcgtcg cgcgccggcctccagttcccggtgggccgcgtgcaccggctgctgcggaagggccactac gccgagcgggtgggcgcgggcgcgccggtgtacctggccgcggtgctcgagtacctcacc gcggagatcctggagctggcgggcaacgcggcccgcgacaacaagaagacgcggatcatc ccccgccacctgcagctggccatccgcaacgacgaggagctcaacaagctgctgggcggc gtgacgatcgcgcaggggggcgtcctgcccaacatccaggccgtgctgctgcccaagaag accagcgccaccgtggggccgaaggcgcccgccggcggcaagaaggccacgcaggcctct caggagtactga

DBGET integrated database retrieval system