Talpa occidentalis (Iberian mole): 119242628 Help Entry 119242628         CDS       T07495                                  Name (RefSeq) transforming protein RhoA-like   KO K04513   Ras homolog gene family, member A Organism tod  Talpa occidentalis (Iberian mole) Pathway tod04014   Ras signaling pathway tod04015   Rap1 signaling pathway tod04022   cGMP-PKG signaling pathway tod04024   cAMP signaling pathway tod04062   Chemokine signaling pathway tod04071   Sphingolipid signaling pathway tod04072   Phospholipase D signaling pathway tod04081   Hormone signaling tod04144   Endocytosis tod04150   mTOR signaling pathway tod04270   Vascular smooth muscle contraction tod04310   Wnt signaling pathway tod04350   TGF-beta signaling pathway tod04360   Axon guidance tod04510   Focal adhesion tod04520   Adherens junction tod04530   Tight junction tod04611   Platelet activation tod04621   NOD-like receptor signaling pathway tod04625   C-type lectin receptor signaling pathway tod04660   T cell receptor signaling pathway tod04670   Leukocyte transendothelial migration tod04722   Neurotrophin signaling pathway tod04810   Regulation of actin cytoskeleton tod04921   Oxytocin signaling pathway tod04928   Parathyroid hormone synthesis, secretion and action tod04972   Pancreatic secretion tod05100   Bacterial invasion of epithelial cells tod05132   Salmonella infection tod05133   Pertussis tod05135   Yersinia infection tod05152   Tuberculosis tod05163   Human cytomegalovirus infection tod05200   Pathways in cancer tod05203   Viral carcinogenesis tod05205   Proteoglycans in cancer tod05206   MicroRNAs in cancer tod05210   Colorectal cancer tod05417   Lipid and atherosclerosis tod05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:tod00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     119242628    04015 Rap1 signaling pathway     119242628    04310 Wnt signaling pathway     119242628    04350 TGF-beta signaling pathway     119242628    04072 Phospholipase D signaling pathway     119242628    04071 Sphingolipid signaling pathway     119242628    04024 cAMP signaling pathway     119242628    04022 cGMP-PKG signaling pathway     119242628    04150 mTOR signaling pathway     119242628   09133 Signaling molecules and interaction    04081 Hormone signaling     119242628  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     119242628   09144 Cellular community - eukaryotes    04510 Focal adhesion     119242628    04520 Adherens junction     119242628    04530 Tight junction     119242628   09142 Cell motility    04810 Regulation of actin cytoskeleton     119242628  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     119242628    04621 NOD-like receptor signaling pathway     119242628    04625 C-type lectin receptor signaling pathway     119242628    04660 T cell receptor signaling pathway     119242628    04670 Leukocyte transendothelial migration     119242628    04062 Chemokine signaling pathway     119242628   09152 Endocrine system    04921 Oxytocin signaling pathway     119242628    04928 Parathyroid hormone synthesis, secretion and action     119242628   09153 Circulatory system    04270 Vascular smooth muscle contraction     119242628   09154 Digestive system    04972 Pancreatic secretion     119242628   09156 Nervous system    04722 Neurotrophin signaling pathway     119242628   09158 Development and regeneration    04360 Axon guidance     119242628  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     119242628    05206 MicroRNAs in cancer     119242628    05205 Proteoglycans in cancer     119242628    05203 Viral carcinogenesis     119242628   09162 Cancer: specific types    05210 Colorectal cancer     119242628   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     119242628   09171 Infectious disease: bacterial    05132 Salmonella infection     119242628    05135 Yersinia infection     119242628    05133 Pertussis     119242628    05152 Tuberculosis     119242628    05100 Bacterial invasion of epithelial cells     119242628   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     119242628    05418 Fluid shear stress and atherosclerosis     119242628  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tod04131]     119242628   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tod04147]     119242628    04031 GTP-binding proteins [BR:tod04031]     119242628 Membrane trafficking [BR:tod04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     119242628 Exosome [BR:tod04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    119242628   Exosomal proteins of other body fluids (saliva and urine)    119242628   Exosomal proteins of colorectal cancer cells    119242628   Exosomal proteins of bladder cancer cells    119242628 GTP-binding proteins [BR:tod04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     119242628 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU VASP_tetra Motif Other DBs NCBI-GeneID:  119242628 NCBI-ProteinID:  XP_037364051 LinkDB All DBs Position Unknown AA seq 112 aa AA seqDB search MCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKP EEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atgtgtttctctattgacagccctgatagtttagaaaacatcccagaaaaatggactcca gaagtcaagcatttctgtcccaacgtgcccatcatcctggttgggaacaagaaggatctt cggaatgatgagcacacaaggcgggagctggccaaaatgaagcaggagccagtaaaacct gaagaaggcagagatatggcaaacaggattggcgcttttgggtacatggaatgttcagca aagaccaaagatggagtgagagaggtttttgaaatggccacgagagctgcgctgcaagcc agacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system