Talpa occidentalis (Iberian mole): 119243330
Help
Entry
119243330 CDS
T07495
Symbol
FGF1
Name
(RefSeq) fibroblast growth factor 1 isoform X1
KO
K18496
fibroblast growth factor 1
Organism
tod
Talpa occidentalis (Iberian mole)
Pathway
tod04010
MAPK signaling pathway
tod04014
Ras signaling pathway
tod04015
Rap1 signaling pathway
tod04020
Calcium signaling pathway
tod04151
PI3K-Akt signaling pathway
tod04390
Hippo signaling pathway
tod04810
Regulation of actin cytoskeleton
tod05200
Pathways in cancer
tod05218
Melanoma
tod05224
Breast cancer
tod05226
Gastric cancer
Brite
KEGG Orthology (KO) [BR:
tod00001
]
09130 Environmental Information Processing
09132 Signal transduction
04010 MAPK signaling pathway
119243330 (FGF1)
04014 Ras signaling pathway
119243330 (FGF1)
04015 Rap1 signaling pathway
119243330 (FGF1)
04390 Hippo signaling pathway
119243330 (FGF1)
04020 Calcium signaling pathway
119243330 (FGF1)
04151 PI3K-Akt signaling pathway
119243330 (FGF1)
09140 Cellular Processes
09142 Cell motility
04810 Regulation of actin cytoskeleton
119243330 (FGF1)
09160 Human Diseases
09161 Cancer: overview
05200 Pathways in cancer
119243330 (FGF1)
09162 Cancer: specific types
05226 Gastric cancer
119243330 (FGF1)
05218 Melanoma
119243330 (FGF1)
05224 Breast cancer
119243330 (FGF1)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
04052 Cytokines and neuropeptides [BR:
tod04052
]
119243330 (FGF1)
00536 Glycosaminoglycan binding proteins [BR:
tod00536
]
119243330 (FGF1)
Cytokines and neuropeptides [BR:
tod04052
]
Cytokines
Growth factors (RTK binding)
119243330 (FGF1)
Glycosaminoglycan binding proteins [BR:
tod00536
]
Heparan sulfate / Heparin
Growth factors/receptors
119243330 (FGF1)
BRITE hierarchy
SSDB
Ortholog
Paralog
GFIT
Motif
Pfam:
FGF
Fascin
Motif
Other DBs
NCBI-GeneID:
119243330
NCBI-ProteinID:
XP_037364942
LinkDB
All DBs
Position
Unknown
AA seq
155 aa
AA seq
DB search
MAEGEITTFTALTEKFNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
NT seq
468 nt
NT seq
+upstream
nt +downstream
nt
atggctgaaggggaaatcacaaccttcaccgccctgactgagaagtttaatctgccgctg
gggaattacaagaagcccaagcttctctactgcagcaacgggggccacttcctgagaatc
cttccagacggcacagtggacgggacaagggacaggagcgaccagcacattcagctgcag
ctcagtgcggaaagtgtgggggaggtgtatataaagagtacggagactggccagtacttg
gccatggacaccgacgggcttttatacggctcacaaacaccaaatgaggaatgtcttttc
ctggaaagactggaggaaaaccattacaacacctacacttccaagaagcatgccgagaag
aattggttcgttggtctcaagaagaatggaagttgcaaacgtggtcctcgaactcactat
ggccagaaagcaatcttgtttctccccctgccagtctcctctgattaa
DBGET
integrated database retrieval system