Talpa occidentalis (Iberian mole): 119243573 Help Entry 119243573         CDS       T07495                                  Symbol ATG12 Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism tod  Talpa occidentalis (Iberian mole) Pathway tod04068   FoxO signaling pathway tod04136   Autophagy - other tod04140   Autophagy - animal tod04621   NOD-like receptor signaling pathway tod04622   RIG-I-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:tod00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     119243573 (ATG12)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     119243573 (ATG12)    04136 Autophagy - other     119243573 (ATG12)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     119243573 (ATG12)    04622 RIG-I-like receptor signaling pathway     119243573 (ATG12)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tod04131]     119243573 (ATG12)    04121 Ubiquitin system [BR:tod04121]     119243573 (ATG12)    03029 Mitochondrial biogenesis [BR:tod03029]     119243573 (ATG12) Membrane trafficking [BR:tod04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     119243573 (ATG12) Ubiquitin system [BR:tod04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    119243573 (ATG12) Mitochondrial biogenesis [BR:tod03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     119243573 (ATG12) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  APG12 ATG8 Motif Other DBs NCBI-GeneID:  119243573 NCBI-ProteinID:  XP_037365386 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search MAEEPEPALQLCPASAAEGEGPTEVSPETATPEPPSSAAVSPGTEEPAGDTKKKIDILLK AVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLY ECFGSDGKLVLHYCKSQAWG NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggcggaggagcccgagccggcgctgcagctctgtccagcaagtgctgctgaaggcgaa ggacccaccgaggtctccccagaaacagccactccggagcccccttcttctgctgcagtc tccccggggacggaggaacctgccggcgacaccaaaaaaaaaattgacatcctgctgaag gctgtgggagacacccctataatgaaaaccaaaaagtgggctgtggagcgaacccgaact atccaaggactcattgacttcatcaaaaagttccttaaacttgtggcctcggaacagttg tttatttatgtaaatcagtcctttgccccctctccagatcaggaagtgggaaccctctat gagtgttttggcagtgatggtaagctggtcctacattactgcaaatctcaggcatggggc tga

DBGET integrated database retrieval system